SUG1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SUG1 Antibody [NBP2-57621] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: SUG1 Antibody [NBP2-57621] - Staining of human testis.
Independent Antibodies: Immunohistochemistry-Paraffin: SUG1 Antibody [NBP2-57621] - Staining of human cerebral cortex, lymph node, skin and testis using Anti-PSMC5 antibody NBP2-57621 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: SUG1 Antibody [NBP2-57621] - Staining of human lymph node.
Immunohistochemistry-Paraffin: SUG1 Antibody [NBP2-57621] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: SUG1 Antibody [NBP2-57621] - Staining of human skin.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

SUG1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLD
Specificity
Specificity of human SUG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMC5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SUG1 Recombinant Protein Antigen (NBP2-57621PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SUG1 Antibody

  • MSUG1 protein
  • p45
  • p45/SUG26S protease regulatory subunit 8
  • proteasome (prosome, macropain) 26S subunit, ATPase, 5
  • proteasome 26S ATPase subunit 5
  • Proteasome 26S subunit ATPase 5
  • Proteasome subunit p45
  • S8
  • SUG-1
  • SUG126S proteasome AAA-ATPase subunit RPT6
  • Tat-binding protein homolog 10
  • TBP10
  • thyroid receptor interactor 1
  • TRIP1Thyroid hormone receptor-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-73636
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, CyTOF-ready
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-33717
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-88192
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NBP2-97622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2682
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-CS, IF
NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SUG1 Antibody (NBP2-57621) (0)

There are no publications for SUG1 Antibody (NBP2-57621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUG1 Antibody (NBP2-57621) (0)

There are no reviews for SUG1 Antibody (NBP2-57621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SUG1 Antibody (NBP2-57621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMC5