RPS7 Antibody (3G4)

Images

 
Western Blot: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of RPS7 expression in Raw 264.7 (Cat # L024V1).
Immunocytochemistry/ Immunofluorescence: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of monoclonal antibody to RPS7 on HeLa cell. Antibody concentration 20 ug/ml
Immunohistochemistry-Paraffin: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of monoclonal antibody to RPS7 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
Western Blot: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of RPS7 expression in HeLa (Cat # L013V1).
Western Blot: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of RPS7 expression in PC-12 (Cat # L012V1).
Western Blot: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of RPS7 expression in NIH/3T3 (Cat # L018V1).
Sandwich ELISA: RPS7 Antibody (3G4) [H00006201-M03] - Detection limit for recombinant GST tagged RPS7 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
3G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RPS7 Antibody (3G4) Summary

Immunogen
RPS7 (NP_001002, 95 a.a. - 194 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL
Specificity
RPS7 - ribosomal protein S7
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPS7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publication using H00006201-M03.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPS7 Antibody (3G4)

  • DBA8,40S ribosomal protein S7
  • ribosomal protein S7

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58885
Species: Hu
Applications: WB, ICC/IF
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-91476
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, Simple Western
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
H00006202-Q01
Species: Hu
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
NBP1-87372
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55793
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
NBP2-75649
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2682
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready, IF
NBP1-57365
Species: Hu, Mu, Rt, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB

Publications for RPS7 Antibody (H00006201-M03)(1)

Reviews for RPS7 Antibody (H00006201-M03) (0)

There are no reviews for RPS7 Antibody (H00006201-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPS7 Antibody (H00006201-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RPS7 Products

Array H00006201-M03

Bioinformatics Tool for RPS7 Antibody (H00006201-M03)

Discover related pathways, diseases and genes to RPS7 Antibody (H00006201-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS7 Antibody (H00006201-M03)

Discover more about diseases related to RPS7 Antibody (H00006201-M03).
 

Pathways for RPS7 Antibody (H00006201-M03)

View related products by pathway.

PTMs for RPS7 Antibody (H00006201-M03)

Learn more about PTMs related to RPS7 Antibody (H00006201-M03).

Blogs on RPS7

There are no specific blogs for RPS7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS7 Antibody (3G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS7
Entrez
OMIM
Uniprot