Novus Biologicals products are now on bio-techne.com

RPS7 Antibody (3G4)

Images

 
Western Blot: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of RPS7 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/ Immunofluorescence: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of monoclonal antibody to RPS7 on HeLa cell. Antibody concentration 20 ug/ml
Immunohistochemistry-Paraffin: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of monoclonal antibody to RPS7 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
Western Blot: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of RPS7 expression in HeLa (Cat # L013V1).
Western Blot: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of RPS7 expression in PC-12 (Cat # L012V1).
Western Blot: RPS7 Antibody (3G4) [H00006201-M03] - Analysis of RPS7 expression in Raw 264.7 (Cat # L024V1).
Sandwich ELISA: RPS7 Antibody (3G4) [H00006201-M03] - Detection limit for recombinant GST tagged RPS7 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
3G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RPS7 Antibody (3G4) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
RPS7 (NP_001002, 95 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL
Specificity
RPS7 - ribosomal protein S7
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RPS7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using
H00006201-M03 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RPS7 Antibody (3G4)

  • DBA8,40S ribosomal protein S7
  • ribosomal protein S7

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94504
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB
H00006192-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94073
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP3-27806
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP2-88192
Species: Hu
Applications: IHC, IHC-P, WB
NB100-345
Species: Hu
Applications: ChIP, IP, KD, WB
NBP1-46191
Species: Dr, Hu, Mu
Applications: IP, WB
NBP2-94502
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006193-M02
Species: Hu, Mu, Pr, Rt
Applications: ELISA, ICC/IF, WB
NB100-2452
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-81545
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-84847
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for RPS7 Antibody (H00006201-M03)(3)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species
Showing Publications 1 - 3 of 3.
Publications using H00006201-M03 Applications Species
Verpelli C, Giona F, Beretta S et al. Decreased expression of ribosomal protein Rpl3 contributes to behavioral deficits caused by Shank3 deficiency Research Square 2023-04-25 (WB, IHC, Mouse) WB, IHC Mouse
Guo Q, Li Y, Zhang Y et al. LncRNA NRON promotes tumorigenesis by enhancing MDM2 activity toward tumor suppressor substrates The EMBO journal 2023-06-29 [PMID: 37382239]
Nicholson J, Scherl A, Way L et al. A systems wide mass spectrometric based linear motif screen to identify dominant in-vivo interacting proteins for the ubiquitin ligase MDM2. Cell Signal 2014-02-28 [PMID: 24583282]

Reviews for RPS7 Antibody (H00006201-M03) (0)

There are no reviews for RPS7 Antibody (H00006201-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPS7 Antibody (H00006201-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPS7 Products

Array H00006201-M03

Research Areas for RPS7 Antibody (H00006201-M03)

Find related products by research area.

Blogs on RPS7

There are no specific blogs for RPS7, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPS7 Antibody (3G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS7
Entrez
OMIM
Uniprot