STX17 Antibody

Images

 
Genetic Strategies: Western Blot: STX17 Antibody [NBP1-93968] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX17 antibody. Remaining relative ...read more
Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Simple Western: STX17 Antibody [NBP1-93968] - Simple Western lane view shows a specific band for STX17 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: STX17 Antibody [NBP1-93968] - Electropherogram image(s) of corresponding Simple Western lane view. STX17 antibody was used at 1:30 dilution on RT-4 and U-251MG sp lysates(s).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

STX17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ
Specificity
Specificity of human, mouse STX17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STX17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Simple Western 1:30
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Positive Control
STX17 Lysate (NBP2-66325)
Control Peptide
STX17 Protein (NBP1-93968PEP)
Publications
Read Publications using
NBP1-93968 in the following applications:

  • 1 publication
  • 1 publication
  • IP
    1 publication
  • WB
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24554770). Mouse reactivity reported in scientific literature (PMID: 28665306). Rat (86%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STX17 Antibody

  • MGC102796
  • MGC126613
  • MGC126615
  • syntaxin 17
  • syntaxin-17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14323
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-P
AF7869
Species: Hu
Applications: WB, ICC
NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
PP-H7833-00
Species: Hu
Applications: WB, IP
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP2-55305
Species: Hu
Applications: WB, ICC/IF
NBP2-66777
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88861
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
H00023071-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-23610
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC
MAB1234
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)

Publications for STX17 Antibody (NBP1-93968)(3)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 4 applications: ICC/IF, IHC-P, IP, WB.


Filter By Application
ICC/IF
(1)
IHC-P
(1)
IP
(1)
WB
(2)
All Applications
Filter By Species
Human
(2)
Mouse
(1)
All Species

Reviews for STX17 Antibody (NBP1-93968) (0)

There are no reviews for STX17 Antibody (NBP1-93968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STX17 Antibody (NBP1-93968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for STX17 Antibody (NBP1-93968)

Discover related pathways, diseases and genes to STX17 Antibody (NBP1-93968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STX17 Antibody (NBP1-93968)

Discover more about diseases related to STX17 Antibody (NBP1-93968).
 

Pathways for STX17 Antibody (NBP1-93968)

View related products by pathway.

Blogs on STX17.

Autophagy independent roles of the core ATG proteins
By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation.  It is critical for removal of dam...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STX17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STX17