STX17 Antibody - BSA Free

Western Blot: STX17 Antibody [NBP1-93968] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX17 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunohistochemistry: STX17 Antibody [NBP1-93968] - Immunohistochemical detection of STX17 in liver tissue. After fixation in neutral buffered formalin for 24 h, liver samples of wild type mice were paraffin-embedded and stained for STX17 using rabbit polyclonal anti-STX17 (Novus Biologicals, Littleton, CO, USA; NBP1-93968). Heat-mediated antigen retrieval was performed in citrate buffer (pH 6.0). An accumulation of STX17-positive dots is detectable after starvation. Scale bar = 20 um. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2073-4409/6/3/17), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.

Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Simple Western: STX17 Antibody [NBP1-93968] - Simple Western lane view shows a specific band for STX17 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: STX17 Antibody [NBP1-93968] - Electropherogram image(s) of corresponding Simple Western lane view. STX17 antibody was used at 1:30 dilution on RT-4 and U-251MG sp lysates(s).

Immunohistochemical detection of STX17 in liver tissue. After fixation in neutral buffered formalin for 24 h, liver samples of wild type mice were paraffin-embedded and stained for STX17 using rabbit polyclonal anti-STX17 (Novus Biologicals, Littleton, CO, USA; NBP1-93968). Heat-mediated antigen retrieval was performed in citrate buffer (pH 6.0). An accumulation of STX17-positive dots is detectable after starvation. Scale bar = 20 μm.

Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.

• Reactivity: Hu, Mu
• Applications: WB, Simple Western, ICC/IF, IHC, IP, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STX17 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit STX17 Antibody - BSA Free (NBP1-93968) is a polyclonal antibody validated for use in IHC, WB, ICC/IF, Simple Western and IP. Anti-STX17 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STX17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in (PMID: 24554770)
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Immunoprecipitation Reported in (PMID: 24554770)
  • Knockdown Validated
  • Simple Western 1:30
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 40 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  STX17 Protein (NBP1-93968PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28665306). Rat (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for STX17 Antibody - BSA Free

• MGC102796
• MGC126613
• MGC126615
• syntaxin 17
• syntaxin-17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for STX17 Antibody (NBP1-93968)(3)

Publications using NBP1-93968

• Martinet W, Roth L, De Meyer GRY. Standard Immunohistochemical Assays to Assess Autophagy in Mammalian Tissue Cells 2017-06-30 [PMID: 28665306] (IHC-P, Mouse)
• Diao J, Liu R, Rong Y et al. ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes. Nature 2015-04-23 [PMID: 25686604] (WB, Human)
• Jiang P, Nishimura T, Sakamaki Y et al. The HOPS complex mediates autophagosome-lysosome fusion through interaction with syntaxin 17. Mol Biol Cell 2014-04-01 [PMID: 24554770] (IP, ICC/IF, WB, Human)

Bioinformatics

• Gene Symbol: STX17