Home » STT3B » STT3B Antibodies » STT3B Antibody

STT3B Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry: STT3B Antibody [NBP2-48657] - Staining of human testis shows cytoplasmic positivity in seminiferus ducts and leydig cells.
Immunohistochemistry: STT3B Antibody [NBP2-48657] - Staining of human testis shows cytoplasmic positivity in seminiferus ducts and leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

STT3B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIK
Predicted Species
Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STT3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STT3B Recombinant Protein Antigen (NBP2-48657PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STT3B Antibody

  • FLJ90106
  • homolog of yeast STT3
  • Oligosaccharyl transferase subunit STT3B
  • SIMPEC 2.4.1.119
  • source of immunodominant MHC associated peptides
  • Source of immunodominant MHC-associated peptides homolog
  • STT3, subunit of the oligosaccharyltransferase complex, homolog B (S.cerevisiae)
  • STT3-Bdolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B

Background

The SIMP protein contains a highly immunogenic minor histocompatibility antigen epitope of 9 amino acids, B6(dom1). Like ITM1 (MIM 601134), SIMP is homologous to yeast STT3, an oligosaccharyltransferase essential for cell proliferation (McBride et al., 2002 [PubMed 12439619]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

STT3A Antibody
(4D4)
H00003703-M02
Western Blot: STT3A Antibody (4D4) [H00003703-M02] - Analysis of ITM1 expression in transfected 293T cell line by ITM1 monoclonal antibody (M02), clone 4D4.Lane 1: ITM1 transfected lysate(80.5 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: STT3A Antibody (4D4) [H00003703-M02] - Analysis of monoclonal antibody to ITM1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
ELISA: STT3A Antibody (4D4) [H00003703-M02] - Detection limit for recombinant GST tagged ITM1 is approximately 1ng/ml as a capture antibody.
(2 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
DDOST Antibody
(OTI2B4)
NBP2-46439
Immunohistochemistry: DDOST Antibody (2B4) [NBP2-46439] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: DDOST Antibody (2B4) [NBP2-46439] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: DDOST Antibody (2B4) [NBP2-46439] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu, Mu, Rt
Applications: IHC, WB
LRRC32/GARP
Antibody
NBP2-24664
Flow Cytometry: LRRC32/GARP Antibody [NBP2-24664] - BALB/c splenocytes stained with anti-GARP (NBP2-24664), with a FITC conjugated secondary (20302), and anti-mouse CD4 PE (IMG-5922D). Viable cells in the lymphocyte gate were used for analysis. Novus's cell surface flow kit (10084K) was used for this test .
Western Blot: LRRC32/GARP Antibody [NBP2-24664] - Analysis of GARP/LRRC32 in mouse thymus lysate in the (1) absence and (2) presence of immunizing peptide using this antibody. 5 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Western Blot: LRRC32/GARP Antibody [NBP2-24664] - Analysis of GARP protein expression; (t test, * P < 0.05). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31198639/) licensed under a CC-BY licence.
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, WB
Fibroblast
Activation Protein al ...
AF3715
Fibroblast Activation Protein  alpha /FAP was detected in immersion fixed paraffin-embedded sections of human squamous cell carcinoma using Sheep Anti-Human Fibroblast Activation Protein  alpha /FAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3715) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to connective tissue. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Fibroblast Activation Protein  alpha /FAP was detected in immersion fixed paraffin-embedded sections of human basal cell carcinoma using Sheep Anti-Human Fibroblast Activation Protein  alpha /FAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3715) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit  (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of WI‑38 human lung fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human Fibroblast Activation Protein  alpha /FAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3715) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Fibroblast Activation Protein  alpha /FAP at approximately 97 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(17 Publications)
Species: Hu
Applications: IHC, IP, KO, Simple Western, WB
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB
PAPOLA Antibody
NBP1-87345
Immunohistochemistry-Paraffin: PAPOLA Antibody [NBP1-87345] - Staining of human prostate shows moderate nuclear positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: PAPOLA Antibody [NBP1-87345] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MRPS30 Antibody
NBP1-87343
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human breast shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human thyroid gland shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu, Rt
Applications: IHC, IHC-P, WB
ASAP1 Antibody
NBP2-48909
Immunohistochemistry-Paraffin: ASAP1 Antibody [NBP2-48909] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Knockout Validated: ASAP1 Antibody [NBP2-48909] - Loss of ASAP1 results in expansion of the hypertrophic zone. E15.5 Asap1+/+ (Q,R) and Asap1GT/GT (S,T). ASAP1 immunostaining indicates specific expression of ASAP1 in the perichondrium, in late hypertrophic chondrocytes and in the primary ossification center. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pgen.1008216) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: ASAP1 Antibody [NBP2-48909] - Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - CD8 alpha expression in mouse spleen tissue using anti-CD8 alpha antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of bone marrow tissue by single and multiple staining.
Immunohistochemistry-Frozen: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of mosue spleen sections. CD8+ lymphocytes are marked by brown labeling of the cell surface.
(3 Reviews)
(20 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
MCF2L Antibody
(1D11)
H00023263-M01
Sandwich ELISA: MCF2L Antibody (1D11) [H00023263-M01] - Detection limit for recombinant GST tagged MCF2L is approximately 0.03ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: MCF2L Antibody (1D11) [H00023263-M01] - Analysis of monoclonal antibody to MCF2L on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 1 ug/ml.
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Reg3A Antibody
NBP2-24763
Western Blot: Reg3A Antibody [NBP2-24763] - Human intestine lysate probed with REG3A antibody at 2 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Reg3A Antibody [NBP2-24763] - Human intestine stained with REG3A antibody (2.5 ug/ml), peroxidase-conjugate and DAB chromogen.
(3 Publications)
Species: Hu, Pm
Applications: IHC, IHC-P, WB
TUSC2 Antibody
NBP3-04411
Immunohistochemistry-Paraffin: TUSC2 Antibody [NBP3-04411] - Paraffin-embedded rat brain using TUSC2 antibody at dilution of 1:200 (40x lens).
Immunohistochemistry-Paraffin: TUSC2 Antibody [NBP3-04411] - Paraffin-embedded mouse kidney using TUSC2 antibody at dilution of 1:200 (40x lens).
Immunohistochemistry-Paraffin: TUSC2 Antibody [NBP3-04411] - Paraffin-embedded mouse heart using TUSC2 antibody at dilution of 1:200 (40x lens).
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PDAP1 Antibody
NBP2-38621
Immunocytochemistry/Immunofluorescence: PDAP1 Antibody [NBP2-38621] - Staining of human cell line U-251 MG shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: PDAP1 Antibody [NBP2-38621] - Staining of human tonsil shows cytoplasmic positivity mainly in germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PAG3 Antibody
NBP2-24614
Western Blot: PAG3 Antibody [NBP2-24614] - Analysis of ASAP2 in human brain lysate using 1) preimmune sera at 1:5000 and 2) protein A purified this antibody. 1.0 ug/ml.
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
Recombinant Human
KRTCAP2 GST (N-Term) ...
H00200185-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
PIBF1 Antibody
NBP2-19823
Western Blot: PIBF1 Antibody [NBP2-19823] - Sample (30 ug of whole cell lysate) A: HCT116 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: PIBF1 Antibody [NBP2-19823] - Analysis of methanol-fixed HCT116, using antibody at 1:500 dilution.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ICC/IF, WB

COMP/Thrombospondin-5
DCMP0
(11 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(739 Publications)
Species: Hu
Applications: BA
FAM188A Antibody
NBP1-88543
Immunohistochemistry-Paraffin: FAM188A Antibody [NBP1-88543] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: FAM188A Antibody [NBP1-88543] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: FAM188A Antibody [NBP1-88543] - Staining of human cell line U-251 MG shows localization to nucleoplasm & nuclear membrane. Antibody staining is shown in green.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
STT3B Antibody
NBP2-48657
STT3B Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for STT3B Antibody (NBP2-48657) (0)

There are no publications for STT3B Antibody (NBP2-48657).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STT3B Antibody (NBP2-48657) (0)

There are no reviews for STT3B Antibody (NBP2-48657). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STT3B Antibody (NBP2-48657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STT3B Products

Array NBP2-48657

Bioinformatics Tool for STT3B Antibody (NBP2-48657)

Discover related pathways, diseases and genes to STT3B Antibody (NBP2-48657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STT3B Antibody (NBP2-48657)

Discover more about diseases related to STT3B Antibody (NBP2-48657).
 

Pathways for STT3B Antibody (NBP2-48657)

View related products by pathway.

PTMs for STT3B Antibody (NBP2-48657)

Learn more about PTMs related to STT3B Antibody (NBP2-48657).

Blogs on STT3B

There are no specific blogs for STT3B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STT3B Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol STT3B