STT3B Antibody

Images

 
Immunohistochemistry: STT3B Antibody [NBP2-48657] - Staining of human testis shows cytoplasmic positivity in seminiferus ducts and leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STT3B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KAPDNRETLDHKPRVTNIFPKQKYLSKKTTKRKRGYIK
Predicted Species
Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STT3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STT3B Recombinant Protein Antigen (NBP2-48657PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STT3B Antibody

  • FLJ90106
  • homolog of yeast STT3
  • Oligosaccharyl transferase subunit STT3B
  • SIMPEC 2.4.1.119
  • source of immunodominant MHC associated peptides
  • Source of immunodominant MHC-associated peptides homolog
  • STT3, subunit of the oligosaccharyltransferase complex, homolog B (S.cerevisiae)
  • STT3-Bdolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B

Background

The SIMP protein contains a highly immunogenic minor histocompatibility antigen epitope of 9 amino acids, B6(dom1). Like ITM1 (MIM 601134), SIMP is homologous to yeast STT3, an oligosaccharyltransferase essential for cell proliferation (McBride et al., 2002 [PubMed 12439619]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003703-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-46439
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-24664
Species: Hu, Mu, Rt
Applications: Flow, WB
AF3715
Species: Hu
Applications: IHC, IP, KO, Simple Western, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
H00023263-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-24763
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
H00200185-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-19823
Species: Hu
Applications: ICC/IF, WB
DCMP0
Species: Hu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
NBP1-88543
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-48657
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for STT3B Antibody (NBP2-48657) (0)

There are no publications for STT3B Antibody (NBP2-48657).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STT3B Antibody (NBP2-48657) (0)

There are no reviews for STT3B Antibody (NBP2-48657). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STT3B Antibody (NBP2-48657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STT3B Products

Array NBP2-48657

Bioinformatics Tool for STT3B Antibody (NBP2-48657)

Discover related pathways, diseases and genes to STT3B Antibody (NBP2-48657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STT3B Antibody (NBP2-48657)

Discover more about diseases related to STT3B Antibody (NBP2-48657).
 

Pathways for STT3B Antibody (NBP2-48657)

View related products by pathway.

PTMs for STT3B Antibody (NBP2-48657)

Learn more about PTMs related to STT3B Antibody (NBP2-48657).

Blogs on STT3B

There are no specific blogs for STT3B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STT3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STT3B