STK38L Antibody

Images

 
Western Blot: STK38L Antibody [NBP1-57030] - ACHN cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STK38L Antibody Summary

Immunogen
Synthetic peptides corresponding to STK38L (serine/threonine kinase 38 like) The peptide sequence was selected from the middle region of STK38L. Peptide sequence PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK38L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against STK38L and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for STK38L Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0965nuclear Dbf2-related 2
  • NDR2 protein kinase
  • NDR2serine/threonine-protein kinase 38-like
  • Nuclear Dbf2-related kinase 2
  • serine/threonine kinase 38 like

Background

STK38L is involved in the regulation of structural processes in differentiating and mature neuronal cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84908
Species: Hu
Applications: WB, IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
H00057447-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-92435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-61873
Species: Hu
Applications: WB, ELISA, Flow, IHC
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-197
Species: Hu, Mu
Applications: WB, IP
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-57030
Species: Hu
Applications: WB

Publications for STK38L Antibody (NBP1-57030) (0)

There are no publications for STK38L Antibody (NBP1-57030).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK38L Antibody (NBP1-57030) (0)

There are no reviews for STK38L Antibody (NBP1-57030). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STK38L Antibody (NBP1-57030) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for STK38L Antibody (NBP1-57030)

Discover related pathways, diseases and genes to STK38L Antibody (NBP1-57030). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK38L Antibody (NBP1-57030)

Discover more about diseases related to STK38L Antibody (NBP1-57030).
 

Pathways for STK38L Antibody (NBP1-57030)

View related products by pathway.

PTMs for STK38L Antibody (NBP1-57030)

Learn more about PTMs related to STK38L Antibody (NBP1-57030).
 

Research Areas for STK38L Antibody (NBP1-57030)

Find related products by research area.

Blogs on STK38L

There are no specific blogs for STK38L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STK38L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STK38L
Uniprot