STIM1 Antibody - BSA Free

Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84323] - Staining of human cerebellum, fallopian tube, kidney and testis using Anti-STIM1 antibody NBP1-84323 (A) shows similar protein distribution across tissues to independent antibody NBP1-84322 (B).

Immunocytochemistry/Immunofluorescence: STIM1 Antibody [NBP1-84323] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84323] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84323] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84323] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84323] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Analysis in human cell lines A-549 and MCF-7 using Anti-STIM1 antibody. Corresponding STIM1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

STIM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit STIM1 Antibody - BSA Free (NBP1-84323) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TAKQALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSH
• Predicted Species: Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STIM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  STIM1 Protein (NBP1-84323PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for STIM1 Antibody - BSA Free

• GOK
• GOKD11S4896E
• STIM1
• stromal interaction molecule 1

Background

Stromal interaction molecule 1 plays a role in mediating Ca(2+) influx following depletion of intracellular Ca(2+) stores. It acts as Ca(2+) sensor in the endoplasmic reticulum via its EF-hand domain. Upon Ca(2+) depletion, it translocates from the endoplasmic reticulum to the plasma membrane where it activates the Ca(2+) release-activated Ca(2+) (CRAC) channel subunit.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STIM1