STIM1 Antibody

Images

 
Orthogonal Strategies: Western Blot: STIM1 Antibody [NBP1-84322] - Analysis in human cell lines A-549 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunocytochemistry/ Immunofluorescence: STIM1 Antibody [NBP1-84322] - Staining of human cell line A549 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Western Blot: STIM1 Antibody [NBP1-84322] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts..
Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Independent Antibodies: Immunohistochemistry-Paraffin: STIM1 Antibody [NBP1-84322] - Staining of human cerebellum, fallopian tube, kidney and testis using Anti-STIM1 antibody NBP1-84322 (A) shows similar protein ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STIM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFK
Specificity
Specificity of human STIM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STIM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
IHC reported in scientific literature (PMID: 24621671). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publication using
NBP1-84322 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24621671).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STIM1 Antibody

  • GOK
  • GOKD11S4896E
  • STIM1
  • stromal interaction molecule 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-75522
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, ISH, PLA, IF
NB100-98844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-89107
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58719
Species: Hu
Applications: WB, ICC/IF
NBP2-76956
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-04611
Species: Hu
NBP2-19630
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6387
Species: Hu
Applications: WB
NBP1-77262
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-32906
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, Flow-IC
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-20989
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB120-5908
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-56749
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84322
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for STIM1 Antibody (NBP1-84322)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for STIM1 Antibody (NBP1-84322) (0)

There are no reviews for STIM1 Antibody (NBP1-84322). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STIM1 Antibody (NBP1-84322) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional STIM1 Products

Bioinformatics Tool for STIM1 Antibody (NBP1-84322)

Discover related pathways, diseases and genes to STIM1 Antibody (NBP1-84322). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STIM1 Antibody (NBP1-84322)

Discover more about diseases related to STIM1 Antibody (NBP1-84322).
 

Pathways for STIM1 Antibody (NBP1-84322)

View related products by pathway.

PTMs for STIM1 Antibody (NBP1-84322)

Learn more about PTMs related to STIM1 Antibody (NBP1-84322).

Blogs on STIM1

There are no specific blogs for STIM1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STIM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STIM1
COVID-19 update