Sterol carrier protein 2 Recombinant Protein Antigen

Images

 
There are currently no images for Sterol carrier protein 2 Recombinant Protein Antigen (NBP1-89514PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Sterol carrier protein 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SYCP2.

Source: E. coli

Amino Acid Sequence: IKMVGFDMSKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SCP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89514.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Sterol carrier protein 2 Recombinant Protein Antigen

  • DKFZp686C12188
  • DKFZp686D11188
  • NLTP
  • non-specific lipid-transfer protein
  • NSL-TP
  • Propanoyl-CoA C-acyltransferase
  • SCP-2
  • SCP-CHI
  • SCPX
  • SCP-X
  • sterol carrier protein 2EC 2.3.1.176
  • Sterol carrier protein X

Background

SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. The full-length nature of all transcript variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87695
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83387
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF1657
Species: Mu
Applications: WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AF3166
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PLA, WB
NB100-93444
Species: Hu
Applications: PEP-ELISA, WB
NBP1-92311
Species: Hu
Applications: IHC,  IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB300-232
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt, RM
Applications: IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-72110
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33485
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56648
Species: Hu, Mu, Rt
Applications: WB
AF1476
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-89514PEP
Species: Hu
Applications: AC

Publications for Sterol carrier protein 2 Recombinant Protein Antigen (NBP1-89514PEP) (0)

There are no publications for Sterol carrier protein 2 Recombinant Protein Antigen (NBP1-89514PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sterol carrier protein 2 Recombinant Protein Antigen (NBP1-89514PEP) (0)

There are no reviews for Sterol carrier protein 2 Recombinant Protein Antigen (NBP1-89514PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Sterol carrier protein 2 Recombinant Protein Antigen (NBP1-89514PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sterol carrier protein 2 Products

Blogs on Sterol carrier protein 2

There are no specific blogs for Sterol carrier protein 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Sterol carrier protein 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SCP2