STEAP2 Antibody


Immunohistochemistry-Paraffin: STEAP2 Antibody [NBP1-83100] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

STEAP2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EYLASLFPDSLIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIE
Specificity of human STEAP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STEAP2 Protein (NBP1-83100PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for STEAP2 Antibody

  • EC 1.16.1
  • EC 1.16.1.-
  • IPCA1
  • metalloreductase STEAP2
  • prostate cancer associated protein 1
  • Prostate cancer-associated protein 1
  • Protein upregulated in metastatic prostate cancer
  • PUMPCn
  • six transmembrane epithelial antigen of prostate 2
  • six transmembrane epithelial antigen of the prostate 2
  • Six-transmembrane epithelial antigen of prostate 2
  • SixTransMembrane protein of prostate 1
  • STAMP1
  • STEAP2
  • STMP


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PAGE
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IA, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for STEAP2 Antibody (NBP1-83100) (0)

There are no publications for STEAP2 Antibody (NBP1-83100).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STEAP2 Antibody (NBP1-83100) (0)

There are no reviews for STEAP2 Antibody (NBP1-83100). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STEAP2 Antibody (NBP1-83100). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.
    • We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?

Secondary Antibodies


Isotype Controls

Additional STEAP2 Products

Bioinformatics Tool for STEAP2 Antibody (NBP1-83100)

Discover related pathways, diseases and genes to STEAP2 Antibody (NBP1-83100). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STEAP2 Antibody (NBP1-83100)

Discover more about diseases related to STEAP2 Antibody (NBP1-83100).

Pathways for STEAP2 Antibody (NBP1-83100)

View related products by pathway.

Blogs on STEAP2

There are no specific blogs for STEAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our STEAP2 Antibody and receive a gift card or discount.


Gene Symbol STEAP2