START domain containing 7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: START domain containing 7 Antibody [NBP2-57423] - Staining of human cell line U-2 OS shows localization to mitochondria.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

START domain containing 7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit START domain containing 7 Antibody - BSA Free (NBP2-57423) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNE
• Predicted Species: Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STARD7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  START domain containing 7 Recombinant Protein Antigen (NBP2-57423PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for START domain containing 7 Antibody - BSA Free

• Gestational trophoblastic tumor protein 1
• GTT1stAR-related lipid transfer protein 7, mitochondrial
• StARD7
• StAR-related lipid transfer (START) domain containing 7
• START domain containing 7
• START domain-containing protein 7

Background

Although the function of this gene is not known, its existence is supported by mRNA and EST data. The predicted gene product contains a region similar to the STAR-related lipid transfer (START) domain, which is often present in proteins involved in the cell signaling mediated by lipid binding. Two alternatively spliced transcript variants that encode an identical protein have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STARD7