STARD10 Antibody

Images

 
Western Blot: STARD10 Antibody [NBP1-84508] - Analysis in human cell lines MCF-7 and HeLa using Anti-STARD10 antibody. Corresponding STARD10 RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunohistochemistry-Paraffin: STARD10 Antibody [NBP1-84508] - Staining of human kidney shows cytoplasmic and nuclear positivity in cells in tubules.
Western Blot: STARD10 Antibody [NBP1-84508] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STARD10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STARD10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STARD10 Protein (NBP1-84508PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STARD10 Antibody

  • Antigen NY-CO-28
  • CGI-52
  • MGC14401
  • NY-CO-28
  • PCTP2
  • PCTP-L
  • PCTP-like protein
  • Serologically defined colon cancer antigen 28SDCCAG28
  • StARD10
  • StAR-related lipid transfer (START) domain containing 10
  • StAR-related lipid transfer protein 10
  • START domain containing 10
  • START domain-containing protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13742
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92177
Species: Hu
Applications: IHC, IHC-P
MAB6860
Species: Hu
Applications: WB, IP
NBP1-85681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB400-106
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92448
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50218
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-07799
Species: Hu
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88813
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for STARD10 Antibody (NBP1-84508) (0)

There are no publications for STARD10 Antibody (NBP1-84508).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STARD10 Antibody (NBP1-84508) (0)

There are no reviews for STARD10 Antibody (NBP1-84508). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STARD10 Antibody (NBP1-84508) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STARD10 Products

Bioinformatics Tool for STARD10 Antibody (NBP1-84508)

Discover related pathways, diseases and genes to STARD10 Antibody (NBP1-84508). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STARD10 Antibody (NBP1-84508)

Discover more about diseases related to STARD10 Antibody (NBP1-84508).
 

Pathways for STARD10 Antibody (NBP1-84508)

View related products by pathway.

PTMs for STARD10 Antibody (NBP1-84508)

Learn more about PTMs related to STARD10 Antibody (NBP1-84508).

Blogs on STARD10

There are no specific blogs for STARD10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STARD10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STARD10