STAP2 Antibody

Images

 
Western Blot: STAP2 Antibody [NBP1-88586] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: STAP2 Antibody [NBP1-88586] - Staining of human cell line U-2 OS shows positivity in vesicles.
Immunohistochemistry-Paraffin: STAP2 Antibody [NBP1-88586] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STAP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
STAP2 Protein (NBP1-88586PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STAP2 Antibody

  • BKSbrk kinase substrate
  • Breast tumor kinase substrate
  • BRK substrate
  • FLJ20234
  • signal transducing adaptor family member 2
  • signal-transducing adaptor protein 2
  • signal-transducing adaptor protein-2
  • STAP-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3966
Species: Hu
Applications: WB, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
AF5717
Species: Hu
Applications: WB
AF497
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB500-597
Species: Hu, Mu, Rt
Applications: WB, Flow, IP
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00114757-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA

Publications for STAP2 Antibody (NBP1-88586) (0)

There are no publications for STAP2 Antibody (NBP1-88586).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAP2 Antibody (NBP1-88586) (0)

There are no reviews for STAP2 Antibody (NBP1-88586). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STAP2 Antibody (NBP1-88586) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAP2 Products

Bioinformatics Tool for STAP2 Antibody (NBP1-88586)

Discover related pathways, diseases and genes to STAP2 Antibody (NBP1-88586). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAP2 Antibody (NBP1-88586)

Discover more about diseases related to STAP2 Antibody (NBP1-88586).
 

Pathways for STAP2 Antibody (NBP1-88586)

View related products by pathway.

PTMs for STAP2 Antibody (NBP1-88586)

Learn more about PTMs related to STAP2 Antibody (NBP1-88586).
 

Research Areas for STAP2 Antibody (NBP1-88586)

Find related products by research area.

Blogs on STAP2

There are no specific blogs for STAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STAP2