STAMP2/STEAP4 Antibody - BSA Free

Western Blot: STAMP2/STEAP4 Antibody [NBP3-10071] - Western blot analysis of STAMP2/STEAP4 in Human Jurkat Whole Cell lysates. Antibody dilution at 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

STAMP2/STEAP4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit STAMP2/STEAP4 Antibody - BSA Free (NBP3-10071) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human STAMP2/STEAP4 (NP_001192244.1). Peptide sequence SNLRWYLPAAYVLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STEAP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for STAMP2/STEAP4 Antibody - BSA Free

• EC 1.16.1
• EC 1.16.1.-
• FLJ23153
• Six-transmembrane epithelial antigen of prostate 4
• SixTransMembrane protein of prostate 2
• STAMP2
• STAMP2DKFZp666D049
• STEAP family member 4
• STEAP4
• TIARP
• TIARPsix transmembrane prostate protein 2
• TNFAIP9
• Tumor necrosis factor, alpha-induced protein 9metalloreductase STEAP4
• tumor necrosis-alpha-induced adipose-related protein

Background

STEAP4 is a member of a family of metalloreductases identified as cell-surface antigens in prostate tissue. It is similar to two other members of the STEAP family, STEAP2 and STEAP3. STEAP4 promotes the reduction of both iron (Fe3+ to Fe2+) and copper (Cu2+ to Cu1+). STEAP4 is highly expressed in placenta, lung, heart and prostate tissues. Furthermore, it is over expressed in prostate cancer cells compared to normal prostate cells. STEAP4 may have a role in cell proliferation and prostrate cancer progression since over expression of STEAP4 in prostate cells significantly increases cell growth and colony formation. At least two isoforms of this protein are known to exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STEAP4