Recombinant Human STAM2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human STAM2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 416-525 of Human STAM2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QSYSLGPDQIGPLRSLPPNVNSSVTAQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
STAM2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human STAM2 Protein

  • DKFZp564C047
  • Hbp
  • Hrs-binding protein
  • HSE1 homolog
  • signal transducing adapter molecule 2
  • signal transducing adaptor molecule (SH3 domain and ITAM motif) 2
  • STAM-2
  • STAM2A
  • STAM2B
  • STAM-like protein containing SH3 and ITAM domains 2

Background

The protein encoded by this gene is closely related to STAM, an adaptor protein involved in the downstream signaling of cytokine receptors, both of which contain a SH3 domain and the immunoreceptor tyrosine-based activation motif (ITAM). Similar to STAM, this protein acts downstream of JAK kinases, and is phosphorylated in response to cytokine stimulation. This protein and STAM thus are thought to exhibit compensatory effects on the signaling pathway downstream of JAK kinases upon cytokine stimulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2200
Species: Hu
Applications: WB, IP
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP2-38514
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP2-24769
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00010254-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for STAM2 Partial Recombinant Protein (H00010254-Q01) (0)

There are no publications for STAM2 Partial Recombinant Protein (H00010254-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAM2 Partial Recombinant Protein (H00010254-Q01) (0)

There are no reviews for STAM2 Partial Recombinant Protein (H00010254-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STAM2 Partial Recombinant Protein (H00010254-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STAM2 Products

Bioinformatics Tool for STAM2 Partial Recombinant Protein (H00010254-Q01)

Discover related pathways, diseases and genes to STAM2 Partial Recombinant Protein (H00010254-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAM2 Partial Recombinant Protein (H00010254-Q01)

Discover more about diseases related to STAM2 Partial Recombinant Protein (H00010254-Q01).
 

Pathways for STAM2 Partial Recombinant Protein (H00010254-Q01)

View related products by pathway.

PTMs for STAM2 Partial Recombinant Protein (H00010254-Q01)

Learn more about PTMs related to STAM2 Partial Recombinant Protein (H00010254-Q01).

Blogs on STAM2

There are no specific blogs for STAM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

STAM2 Antibody
NBP1-83288
Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human STAM2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STAM2