ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 (NP_001291379.1). Peptide sequence GSFYTHSPLTIQLTLSSHRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQR |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ST8SIA1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody - BSA Free
Background
ST8SIA1 - ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Publications for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP3-10589) (0)
There are no publications for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP3-10589).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP3-10589) (0)
There are no reviews for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP3-10589).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP3-10589) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Products
Research Areas for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP3-10589)
Find related products by research area.
|
Blogs on ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3