N-Acetylmannosamine Kinase/GNE Antibody

Images

 
Western Blot: N-Acetylmannosamine Kinase/GNE Antibody [NBP1-81621] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: N-Acetylmannosamine Kinase/GNE Antibody [NBP1-81621] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & mitochondria. Antibody staining is ...read more
Immunohistochemistry-Paraffin: N-Acetylmannosamine Kinase/GNE Antibody [NBP1-81621] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

N-Acetylmannosamine Kinase/GNE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VPFDQFIQLVAHAGCMIGNSSCGVREVGAFGTPVINLGTRQIGRETGENVLHVRDADTQDKILQALHLQFGKQYPCSKIYGDGNAVPRILKFLKSIDLQEPLQKKFCFPPVKENISQDIDHILETLSALAVDLGGTNLRVA
Specificity
Specificity of human N-Acetylmannosamine Kinase/GNE antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
N-Acetylmannosamine Kinase/GNE Protein (NBP1-81621PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for N-Acetylmannosamine Kinase/GNE Antibody

  • bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
  • DMRV
  • GLCNE
  • GLCNENM
  • glucosamine (UDP-N-acetyl)-2-epimerase/N-acetylmannosamine kinase
  • GNE
  • IBM2
  • NAcetylmannosamine Kinase
  • N-Acetylmannosamine Kinase
  • N-acylmannosamine kinase
  • Uae1
  • UDP-GlcNAc-2-epimerase/ManAc kinase
  • UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
  • UDP-N-acetylglucosamine-2-epimerase/N-acetylmannosamine kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE, Flow-CS
NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-20492
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-89750
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66814
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00055907-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03390
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF3844
Species: Hu, Mu
Applications: IHC
NBP1-88522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for N-Acetylmannosamine Kinase/GNE Antibody (NBP1-81621) (0)

There are no publications for N-Acetylmannosamine Kinase/GNE Antibody (NBP1-81621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N-Acetylmannosamine Kinase/GNE Antibody (NBP1-81621) (0)

There are no reviews for N-Acetylmannosamine Kinase/GNE Antibody (NBP1-81621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for N-Acetylmannosamine Kinase/GNE Antibody (NBP1-81621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for N-Acetylmannosamine Kinase/GNE Antibody (NBP1-81621)

Discover related pathways, diseases and genes to N-Acetylmannosamine Kinase/GNE Antibody (NBP1-81621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N-Acetylmannosamine Kinase/GNE Antibody (NBP1-81621)

Discover more about diseases related to N-Acetylmannosamine Kinase/GNE Antibody (NBP1-81621).
 

Pathways for N-Acetylmannosamine Kinase/GNE Antibody (NBP1-81621)

View related products by pathway.

PTMs for N-Acetylmannosamine Kinase/GNE Antibody (NBP1-81621)

Learn more about PTMs related to N-Acetylmannosamine Kinase/GNE Antibody (NBP1-81621).

Blogs on N-Acetylmannosamine Kinase/GNE

There are no specific blogs for N-Acetylmannosamine Kinase/GNE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N-Acetylmannosamine Kinase/GNE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNE