ST6GALNAC1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: ST6GALNAC1 Antibody [NBP1-87043] - Analysis in human rectum and skeletal muscle tissues. Corresponding ST6GALNAC1 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: ST6GALNAC1 Antibody [NBP1-87043] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: ST6GALNAC1 Antibody [NBP1-87043] - Staining of human rectum shows strong positivity in Golgi apparatus in glandular cells.
Immunohistochemistry-Paraffin: ST6GALNAC1 Antibody [NBP1-87043] - Staining of human stomach shows strong positivity in Golgi apparatus in glandular cells.
Immunohistochemistry-Paraffin: ST6GALNAC1 Antibody [NBP1-87043] - Staining of human endometrium shows strong positivity in Golgi apparatus in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ST6GALNAC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PQTKPSRHQRTENIKERSLQSLAKPKSQAPTRARRTTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQRAAWKSPEKEKTMVNTLSPRGQDAGMASGRTEAQSWKSQDTKTTQGN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST6GALNAC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence -Reported in scientific literature (PMID: 30401951)
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ST6GALNAC1 Protein (NBP1-87043PEP)
Publications
Read Publications using
NBP1-87043 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ST6GALNAC1 Antibody

  • alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
  • EC 2.4.99.3
  • GalNAc alpha-2, 6-sialyltransferase I, long form
  • GalNAc alpha-2,6-sialyltransferase I
  • sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) A
  • Sialyltransferase 7A
  • Siat7A
  • SIAT7-A
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 1
  • ST6GalNAc I
  • ST6GALNAC1
  • ST6GalNAcI
  • ST6GalNAcIHSY11339
  • STYI

Background

Glycosylation of proteins affects cell-cell interaction, interactions with the matrix, and the functions of intracellular molecules. ST6GALNAC1 transfers a sialic acid, N-acetylneuraminic acid (NeuAc), in an alpha-2,6 linkage to O-linked GalNAc residues. The cancer-associated sialyl-Tn (sTn) antigen is formed by ST6GALNAC1-catalyzed sialylation of GalNAc residues on mucins (Ikehara et al., 1999 [PubMed 10536037]; Sewell et al., 2006 [PubMed 16319059]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20494
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-60046
Species: Bv, Eq, Gt, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
NBP1-88478
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP3-16604
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
AF4160
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
NBP2-21792
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-02996
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00010049-M01
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
NBP1-84083
Species: Hu
Applications: IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-88476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
NBP3-12196
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
NBP1-87043
Species: Hu
Applications: ICC/IF, IHC

Publications for ST6GALNAC1 Antibody (NBP1-87043)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, IF/IHC.


Filter By Application
ICC/IF
(1)
IF/IHC
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for ST6GALNAC1 Antibody (NBP1-87043) (0)

There are no reviews for ST6GALNAC1 Antibody (NBP1-87043). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ST6GALNAC1 Antibody (NBP1-87043) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST6GALNAC1 Products

Diseases for ST6GALNAC1 Antibody (NBP1-87043)

Discover more about diseases related to ST6GALNAC1 Antibody (NBP1-87043).
 

Pathways for ST6GALNAC1 Antibody (NBP1-87043)

View related products by pathway.

PTMs for ST6GALNAC1 Antibody (NBP1-87043)

Learn more about PTMs related to ST6GALNAC1 Antibody (NBP1-87043).

Blogs on ST6GALNAC1

There are no specific blogs for ST6GALNAC1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST6GALNAC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST6GALNAC1