ST6GALNAC1 Antibody

Images

 
Immunohistochemistry: ST6GALNAC1 Antibody [NBP1-87043] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST6GALNAC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PQTKPSRHQRTENIKERSLQSLAKPKSQAPTRARRTTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQRAAWKSPEKEKTMVNTLSPRGQDAGMASGRTEAQSWKSQDTKTTQGN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST6GALNAC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ST6GALNAC1 Protein (NBP1-87043PEP)
Publications
Read Publication using
NBP1-87043 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ST6GALNAC1 Antibody

  • alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
  • EC 2.4.99.3
  • GalNAc alpha-2, 6-sialyltransferase I, long form
  • GalNAc alpha-2,6-sialyltransferase I
  • sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) A
  • Sialyltransferase 7A
  • Siat7A
  • SIAT7-A
  • ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 1
  • ST6GalNAc I
  • ST6GALNAC1
  • ST6GalNAcI
  • ST6GalNAcIHSY11339
  • STYI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13392
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88478
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-16890
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF4160
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84082
Species: Hu
Applications: IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00056913-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87043
Species: Hu
Applications: IHC, IHC-P

Publications for ST6GALNAC1 Antibody (NBP1-87043)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ST6GALNAC1 Antibody (NBP1-87043) (0)

There are no reviews for ST6GALNAC1 Antibody (NBP1-87043). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ST6GALNAC1 Antibody (NBP1-87043) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST6GALNAC1 Products

Bioinformatics Tool for ST6GALNAC1 Antibody (NBP1-87043)

Discover related pathways, diseases and genes to ST6GALNAC1 Antibody (NBP1-87043). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST6GALNAC1 Antibody (NBP1-87043)

Discover more about diseases related to ST6GALNAC1 Antibody (NBP1-87043).
 

Pathways for ST6GALNAC1 Antibody (NBP1-87043)

View related products by pathway.

PTMs for ST6GALNAC1 Antibody (NBP1-87043)

Learn more about PTMs related to ST6GALNAC1 Antibody (NBP1-87043).

Blogs on ST6GALNAC1

There are no specific blogs for ST6GALNAC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST6GALNAC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST6GALNAC1
Entrez