NAV1 Antibody (NBP1-84083)

Images

 
Immunohistochemistry-Paraffin: NAV1 Antibody [NBP1-84083] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAV1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RETMHNMQLEVDLLKAENDRLKVAPGPSSGSTPGQVPGSSALSSPRRSLGLALTHSFGPSLADTDLSPMDGISTCGPKEEVTLRVVVRMPPQHIIKGDLKQQEFFLGCSKVSGKVDWKMLDEAVFQVFKDYISKMDPASTLGLSTESIH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAV1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
NAV1 Protein (NBP1-84083PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAV1 Antibody

  • FLJ12560
  • FLJ14203
  • KIAA1151POMFIL3DKFZp781D0314
  • KIAA1213
  • MGC14961
  • neuron navigator 1
  • neuron navigator-1
  • pore membrane and/or filament interacting like protein 3
  • Pore membrane and/or filament-interacting-like protein 3
  • STEERIN1
  • steerin-1
  • Unc-53 homolog 1
  • UNC53H1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006326-Q01
Species: Hu
NBP1-47615
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84615
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-591
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
H00006329-R01
Species: Hu
H00006334-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-85298
Species: Hu
Applications: WB, IHC, IHC-P
H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-82600
Species: Hu
Applications: IHC, IHC-P
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4339
Species: Hu, Mu, Rt
Applications: WB
NBP2-46641
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for NAV1 Antibody (NBP1-84083) (0)

There are no publications for NAV1 Antibody (NBP1-84083).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAV1 Antibody (NBP1-84083) (0)

There are no reviews for NAV1 Antibody (NBP1-84083). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NAV1 Antibody (NBP1-84083) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAV1 Products

Related Products by Gene

Bioinformatics Tool for NAV1 Antibody (NBP1-84083)

Discover related pathways, diseases and genes to NAV1 Antibody (NBP1-84083). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAV1 Antibody (NBP1-84083)

Discover more about diseases related to NAV1 Antibody (NBP1-84083).
 

Pathways for NAV1 Antibody (NBP1-84083)

View related products by pathway.

PTMs for NAV1 Antibody (NBP1-84083)

Learn more about PTMs related to NAV1 Antibody (NBP1-84083).

Blogs on NAV1

There are no specific blogs for NAV1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAV1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAV1