C1GALT1C1 Antibody

Images

 
Western Blot: C1GALT1C1 Antibody [NBP1-88478] - Analysis in control (vector only transfected HEK293T lysate) and C1GALT1C1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunocytochemistry/ Immunofluorescence: C1GALT1C1 Antibody [NBP1-88478] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: C1GALT1C1 Antibody [NBP1-88478] - Staining of human liver shows cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C1GALT1C1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C1GALT1C1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C1GALT1C1 Protein (NBP1-88478PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C1GALT1C1 Antibody

  • beta 1,3-galactosyltransferase 2
  • C1GalT1C1
  • C1GALT1-specific chaperone 1
  • C1GalT2
  • C1Gal-T2
  • C1GALT2MGC19947
  • C38H2-L1
  • Core 1 beta1,3-galactosyltransferase 2
  • Core 1 beta3-galactosyltransferase-specific molecular chaperone
  • Core 1 beta3-Gal-T2
  • COSMC
  • COSMCC38H2-like protein 1
  • MST143
  • TNPS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00056913-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF4160
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32394
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2038
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
AF1476
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-33872
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP1-88478
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for C1GALT1C1 Antibody (NBP1-88478) (0)

There are no publications for C1GALT1C1 Antibody (NBP1-88478).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1GALT1C1 Antibody (NBP1-88478) (0)

There are no reviews for C1GALT1C1 Antibody (NBP1-88478). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C1GALT1C1 Antibody (NBP1-88478) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C1GALT1C1 Products

Bioinformatics Tool for C1GALT1C1 Antibody (NBP1-88478)

Discover related pathways, diseases and genes to C1GALT1C1 Antibody (NBP1-88478). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C1GALT1C1 Antibody (NBP1-88478)

Discover more about diseases related to C1GALT1C1 Antibody (NBP1-88478).
 

Pathways for C1GALT1C1 Antibody (NBP1-88478)

View related products by pathway.

PTMs for C1GALT1C1 Antibody (NBP1-88478)

Learn more about PTMs related to C1GALT1C1 Antibody (NBP1-88478).

Blogs on C1GALT1C1

There are no specific blogs for C1GALT1C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C1GALT1C1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C1GALT1C1
Entrez