ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody

Images

 
Western Blot: ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody [NBP1-74154] - Mouse Small Intestine Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of St6gal2. Immunizing peptide sequence RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST6GAL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against St6gal2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody

  • Alpha 2,6-ST 2
  • beta-galactoside alpha-2,6-sialyltransferase 2
  • beta-galactoside alpha-2,6-sialyltransferase II
  • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2
  • EC 2.4.99
  • EC 2.4.99.1
  • FLJ30711
  • FLJ37730
  • FLJ38334
  • hST6Gal II
  • KIAA1877
  • KIAA1877St6gal2
  • sialyltransferase 2 (monosialoganglioside sialyltransferase)
  • Sialyltransferase 2
  • SIAT2
  • ST6 beta-galactosamide alpha-2,6-sialyltranferase 2
  • ST6Gal II
  • ST6GAL2
  • ST6GalII

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5924
Species: Hu
Applications: WB, Simple Western
NBP1-91748
Species: Hu
Applications: IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB100-757
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27398
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-Fr, IHC-P, IP
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-87832
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85373
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5286
Species: Hu
Applications: WB
AF5964
Species: Hu
Applications: WB, IP, ICC
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
1635-T2
Species: Hu
NBP1-85987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4495
Species: Mu
Applications: WB, Flow, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-90235
Species: Hu, Mu, Rt, ChHa
Applications: WB, Simple Western, IHC, IHC-P
AF5165
Species: Hu, Mu
Applications: WB
NBP1-74154
Species: Mu
Applications: WB

Publications for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154) (0)

There are no publications for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154) (0)

There are no reviews for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154)

Discover related pathways, diseases and genes to ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154)

Discover more about diseases related to ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154).
 

Pathways for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154)

View related products by pathway.

PTMs for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154)

Learn more about PTMs related to ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154).

Blogs on ST6 Gal Sialyltransferase 2/ST6GAL2

There are no specific blogs for ST6 Gal Sialyltransferase 2/ST6GAL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST6GAL2
Entrez
Uniprot