ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody


Western Blot: ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody [NBP1-74154] - Mouse Small Intestine Lysate 1ug/ml Gel Concentration 12%

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody Summary

Synthetic peptides corresponding to the C terminal of St6gal2. Immunizing peptide sequence RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against St6gal2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody

  • Alpha 2,6-ST 2
  • beta-galactoside alpha-2,6-sialyltransferase 2
  • beta-galactoside alpha-2,6-sialyltransferase II
  • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2
  • EC 2.4.99
  • EC
  • FLJ30711
  • FLJ37730
  • FLJ38334
  • hST6Gal II
  • KIAA1877
  • KIAA1877St6gal2
  • sialyltransferase 2 (monosialoganglioside sialyltransferase)
  • Sialyltransferase 2
  • SIAT2
  • ST6 beta-galactosamide alpha-2,6-sialyltranferase 2
  • ST6Gal II
  • ST6GAL2
  • St6GalII


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-Fr, IHC-P, IP
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IP, ICC
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, ChHa
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu
Applications: WB

Publications for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154) (0)

There are no publications for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154) (0)

There are no reviews for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154)

Discover related pathways, diseases and genes to ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154)

Discover more about diseases related to ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154).

Pathways for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154)

View related products by pathway.

PTMs for ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154)

Learn more about PTMs related to ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody (NBP1-74154).

Blogs on ST6 Gal Sialyltransferase 2/ST6GAL2

There are no specific blogs for ST6 Gal Sialyltransferase 2/ST6GAL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ST6 Gal Sialyltransferase 2/ST6GAL2 Antibody and receive a gift card or discount.


Gene Symbol ST6GAL2