ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to ST3GAL1(ST3 beta-galactoside alpha-2,3-sialyltransferase 1) The peptide sequence was selected from the C terminal of ST3GAL1.
Peptide sequence YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ST3GAL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
39 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody - BSA Free
Background
ST3GAL1 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. It is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of ST3GAL1 protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of the encoded protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B. Two transcript variants encoding the same protein have been found for this gene. Other transcript variants may exist, but have not been fully characterized yet.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
Species: Hu
Applications: ICC, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, Func
Species: Ha, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Pm
Applications: Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Publications for ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody (NBP1-62540)(1)
Showing Publication 1 -
1 of 1.
Reviews for ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody (NBP1-62540) (0)
There are no reviews for ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody (NBP1-62540).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody (NBP1-62540) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Products
Blogs on ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A