SSR3 Antibody

Images

 
Western Blot: SSR3 Antibody [NBP1-80667] - Analysis in human cell line RPMI-8226.
Immunocytochemistry/ Immunofluorescence: SSR3 Antibody [NBP1-80667] - Staining of mouse trigeminal nucleus shows positivity in neurons and their processes.
Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Western Blot: SSR3 Antibody [NBP1-80667] - Analysis of human dermal fibroblasts at 1:500 dilution. Image provided by verified customer review.
Western Blot: SSR3 Antibody [NBP1-80667] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Western Blot: SSR3 Antibody [NBP1-80667] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebellum tissue
Western Blot: SSR3 Antibody [NBP1-80667] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: SSR3 Antibody [NBP1-80667] - Staining of mouse choroid plexus shows strong immunoreactivity in a subset of cells.
Immunocytochemistry/ Immunofluorescence: SSR3 Antibody [NBP1-80667] - Staining of mouse brain shows strong immunoreactivity in median eminens.
Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human lateral ventricle shows weak positivity in neuropil and a few neurons.
Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of mouse basal forebrain shows weak labeling in the caudate putamen.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SSR3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEA
Specificity
Specificity of human, mouse, rat SSR3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SSR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SSR3 Protein (NBP1-80667PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-80667 in the following applications:

Publications
Read Publication using
NBP1-80667 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SSR3 Antibody

  • signal sequence receptor, gamma (translocon-associated protein gamma)
  • SSR gamma
  • SSR-gamma
  • translocon-associated protein gamma subunit
  • translocon-associated protein subunit gamma
  • TRAP-complex gamma subunit
  • TRAP-gamma
  • TRAPGSignal sequence receptor subunit gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69471
Species: Hu
Applications: WB, IHC, IHC-P
NB100-64650
Species: Hu, Mu, Rt, Po, GP, Ze
Applications: IHC, IHC-Fr, IHC-P
MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
126-FL/CF
Species: Hu
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-65239
Species: Hu
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-89631
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-92607
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB6549
Species: Hu
Applications: WB

Publications for SSR3 Antibody (NBP1-80667)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for SSR3 Antibody (NBP1-80667) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-80667:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot SSR3 NBP1-80667
Enlarge
reviewed by:
Marie-estelle LOSFELD
WB Human 02/27/2014
View

Summary

ApplicationWestern Blot
Sample Testedhuman dermal fibroblasts
SpeciesHuman
Lotr05674

Blocking

Blocking Details5% milk in TBS tween

Primary Anitbody

Dilution Ratio1/500 incubation 3h RT in 5% milk in TBS-tween

Secondary Antibody

Secondary Descriptionanti-Rabbit IgG HRP from amersham
Secondary Concentration1/5000

Details

Detection NotesECL, Biorad

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SSR3 Antibody (NBP1-80667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Marie-estelle LOSFELD
02/27/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol SSR3