SSR3 Antibody - BSA Free

Western Blot: SSR3 Antibody [NBP1-80667] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human salivary gland shows strong granular cytoplasmic positivity in glandular cells.

Western Blot: SSR3 Antibody [NBP1-80667] - Analysis in human cell line RPMI-8226.

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: SSR3 Antibody [NBP1-80667] - Staining of human lymph node shows strong cytoplasmic postitivity in non-geminal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SSR3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SSR3 Antibody - BSA Free (NBP1-80667) is a polyclonal antibody validated for use in IHC and WB. Anti-SSR3 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSR3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SSR3 Protein (NBP1-80667PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SSR3 Antibody - BSA Free

• signal sequence receptor, gamma (translocon-associated protein gamma)
• SSR gamma
• SSR-gamma
• translocon-associated protein gamma subunit
• translocon-associated protein subunit gamma
• TRAP-complex gamma subunit
• TRAP-gamma
• TRAPGSignal sequence receptor subunit gamma

Background

The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR is comprised of four membrane proteins/subunits: alpha, beta, gamma, and delta. The first two are glycosylated subunits and the latter two are non-glycosylated subunits. The protein encoded by this gene is the gamma subunit and is predicted to span the membrane four times. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SSR3 Antibody (NBP1-80667)(3)

Publications using NBP1-80667

• Abdallah S, Jampy A, Moison D et al. Foetal exposure to the bisphenols BADGE and BPAF impairs meiosis through DNA oxidation in mouse ovaries Environmental Pollution 2022-12-01 [PMID: 36464114] (IF/IHC, Mouse)
• Reut D, Jhee H, Caroline B et al. Neuronal IRE-1 coordinates an organism-wide cold stress response by regulating fat metabolism Cell reports 2022-11-29 [PMID: 36450261] (WB)
• Losfeld ME, Ng BG, Kircher M et al. A new congenital disorder of glycosylation caused by a mutation in SSR4, the signal sequence receptor 4 protein of the TRAP complex. Hum Mol Genet. 2013-11-13 [PMID: 24218363] (WB, Human)

Review for SSR3 Antibody (NBP1-80667) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Marie-estelle LOSFELD WB Human 02/27/2014

Summary

• Application: Western Blot
• Sample Tested: human dermal fibroblasts
• Species: Human
• Lot: r05674

Bioinformatics

• Gene Symbol: SSR3
• Entrez:
  • 6747(Human)