We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

SSBP2 Recombinant Protein Antigen

Images

 
There are currently no images for SSBP2 Recombinant Protein Antigen (NBP3-17937PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SSBP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SSBP2

Source: E. coli

Amino Acid Sequence: KLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SSBP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17937.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SSBP2 Recombinant Protein Antigen

  • DKFZp686F03273
  • HSPC116
  • Sequence-specific single-stranded-DNA-binding protein 2
  • single-stranded DNA binding protein 2
  • single-stranded DNA-binding protein 2
  • SOSS-B2
  • SSDP2

Background

SSBP2 is a gene that codes for a protein with five isoforms, with lengths of 361, 298, 341, 331, and 339 amino acids and weights of approximately 38, 31, 36, 35, and 36 amino acids respectively. The protein coded by SSPB2 is involved in the maintenance of genome stability. Current research is being done on several diseases and disorders linked to this gene including anorexia nervosa, carcinoma, leukemia, myeloproliferative disorder, lissencephaly, hematopoiesis, esophagitis, prostate cancer, and prostatitis. SSBP2 has also been shown to have interactions with LDB1, IL36RN, TAL1, DYRK2, and LDB2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00023648-M01
Species: Hu, Mu
Applications: ELISA, S-ELISA, WB
NBP1-31362
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP3-23662
Species: Hu
Applications: Flow, ICC/IF,  IHC-P
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80720
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, KD, WB
DGD150
Species: Hu
Applications: ELISA
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-01926
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF640
Species: Mu
Applications: IHC, WB
NBP2-01578
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
H00058493-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-81988
Species: Hu
Applications: IHC,  IHC-P
MAB7555
Species: Hu
Applications: Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB100-2596
Species: Hu, Mu
Applications: CHIP-SEQ, IHC,  IHC-P, IP, WB
NBP1-86090
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-17937PEP
Species: Hu
Applications: AC

Publications for SSBP2 Recombinant Protein Antigen (NBP3-17937PEP) (0)

There are no publications for SSBP2 Recombinant Protein Antigen (NBP3-17937PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSBP2 Recombinant Protein Antigen (NBP3-17937PEP) (0)

There are no reviews for SSBP2 Recombinant Protein Antigen (NBP3-17937PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SSBP2 Recombinant Protein Antigen (NBP3-17937PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SSBP2 Products

Blogs on SSBP2

There are no specific blogs for SSBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SSBP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SSBP2