SSB Antibody - BSA Free

Western Blot: SSB Antibody [NBP1-82851] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-555

Immunocytochemistry/Immunofluorescence: SSB Antibody [NBP1-82851] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Western Blot: SSB Antibody [NBP1-82851] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: SSB Antibody [NBP1-82851] - Staining of human lymph node shows strong nuclear positivity in germinal center cells and non-germinal center cells.

Immunohistochemistry-Paraffin: SSB Antibody [NBP1-82851] - Staining of human prostate shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SSB Antibody [NBP1-82851] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli and cells in tubules.

Immunohistochemistry-Paraffin: SSB Antibody [NBP1-82851] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells and decidual cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SSB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SSB Antibody - BSA Free (NBP1-82851) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SSB Protein (NBP1-82851PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SSB Antibody - BSA Free

• La autoantigen
• La ribonucleoprotein
• lupus La protein
• member 3
• Sjoegren syndrome type B antigen
• Sjogren syndrome antigen B (autoantigen La)
• SS-B
• SS-B/La protein

Background

Members of the suppressor of cytokine signaling (SOCS) family of proteins contain C-terminal regions of homology called the SOCS box, which serves to couple SOCS proteins and their binding partners with the Elongin B and C complex, thereby mediating protein degradation. Several other families of proteins also contain SOCS boxes, but differ from the SOCS proteins in the type of domain they contain upstream of the SOCS box. SSB-2 (SplA/ryanodine (SPRY) receptor domain-containing SOCS box protein 2), also known as GGRCC9 (gene-rich cluster protein C9), SPSB2 or MGC2519, is a cytoplasmic protein belonging to the SPSB family of proteins that contain a central SPRY domain and a C-terminal SOCS box. The SPRY domain is believed to be a protein-protein interaction motif. Members of the SPSB family are capable of interacting with Met (a receptor for hepatocyte growth factors (HGFs)), and SSB-1 is known to promote HGF signaling. SSB-1, SSB-2 and SSB-4 are also able to interact with PAR4 (prostate apoptosis response protein 4). Mutations in the genes encoding SPSB proteins are associated with several human diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SSB