SREBP1 Recombinant Protein Antigen

Images

 
There are currently no images for SREBP1 Recombinant Protein Antigen (NBP2-54707PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SREBP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SREBP1

Source: E.coli

Amino Acid Sequence: SLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAI

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SREBF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-54707. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SREBP1 Recombinant Protein Antigen

  • BHLHD1
  • Class D basic helix-loop-helix protein 1
  • SREBP 1c
  • SREBP-1
  • SREBP1bHLHd1SREBP-1c
  • sterol regulatory element binding protein-1
  • sterol regulatory element binding transcription factor 1
  • sterol regulatory element-binding protein 1
  • Sterol regulatory element-binding transcription factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
NBP2-89114
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7550
Species: Hu
Applications: WB, KO
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-66888
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IP
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, KO
NBP2-54707PEP
Species: Hu
Applications: AC

Publications for SREBP1 Recombinant Protein Antigen (NBP2-54707PEP) (0)

There are no publications for SREBP1 Recombinant Protein Antigen (NBP2-54707PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SREBP1 Recombinant Protein Antigen (NBP2-54707PEP) (0)

There are no reviews for SREBP1 Recombinant Protein Antigen (NBP2-54707PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SREBP1 Recombinant Protein Antigen (NBP2-54707PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional SREBP1 Products

Bioinformatics Tool for SREBP1 Recombinant Protein Antigen (NBP2-54707PEP)

Discover related pathways, diseases and genes to SREBP1 Recombinant Protein Antigen (NBP2-54707PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SREBP1 Recombinant Protein Antigen (NBP2-54707PEP)

Discover more about diseases related to SREBP1 Recombinant Protein Antigen (NBP2-54707PEP).
 

Pathways for SREBP1 Recombinant Protein Antigen (NBP2-54707PEP)

View related products by pathway.

PTMs for SREBP1 Recombinant Protein Antigen (NBP2-54707PEP)

Learn more about PTMs related to SREBP1 Recombinant Protein Antigen (NBP2-54707PEP).
 

Research Areas for SREBP1 Recombinant Protein Antigen (NBP2-54707PEP)

Find related products by research area.

Blogs on SREBP1.

Metabolic Syndrome: Symptoms and associated disease states
By Jamshed Arslan, Pharm. D., PhD. What is metabolic syndrome?It was 1988 when, after decades of research, Dr. GM Reaven    of the Stanford University, CA, explained the relationship between four diseases:...  Read full blog post.

SREBP2 - regulating cholesterol homeostasis and lipid metabolism
Sterol regulatory element-binding proteins (SREBP) are important transcription factors regulating the synthesis and uptake of lipids including cholesterol. This essential role in lipid metabolism makes investigations into the functions SREBPs im...  Read full blog post.

SREBP: Gatekeeper of Cholesterol Homeostasis
SREBP1 (sterol-regulatory-element-binding protein 2) is a basic-helix-loop-helix-leucine zipper (bHLH-ZIP) transcription factor. It regulates sterol and cholesterol homeostasis by controlling enzymes involved in cholesterol synthesis and uptake, e.g....  Read full blog post.

Customers Who Bought This Also Bought

CHREBP Antibody
NB400-135

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SREBP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SREBF1