Recombinant Human SRD5A2 Protein

• Reactivity: Hu
• Applications: AP

Recombinant Human SRD5A2 Protein Summary

• Description: An un-tagged recombinant protein corresponding SRD5A2 (ADR82875.1)
  
  

  Source: Wheat Germ (in vitro) with proprietary liposome technology

  Amino Acid Sequence: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF

• Preparation Method: in vitro wheat germ expression system with proprietary liposome technology
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: SRD5A2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Immunoaffinity Purification
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 25 mM Tris-HCl pH8.0 in 2% glycerol.
• Preservative: Glycerol
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SRD5A2 Protein

• 3-oxo-5-alpha-steroid 4-dehydrogenase 2,5 alpha-SR2
• 5 alpha-SR2
• EC 1.3.99.5
• MGC138457
• S5AR 2
• SR type 2
• SRD5A2
• Steroid 5-alpha-reductase 2,3-oxo-5 alpha-steroid 4-dehydrogenase 2
• steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta4-dehydrogenase alpha 2)
• Type II 5-alpha reductase

Background

SRD5A2 encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: SRD5A2
• OMIM:
  • 264600(Human)