SPINK2 Antibody


Immunohistochemistry-Paraffin: SPINK2 Antibody [NBP1-83133] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: SPINK2 Antibody [NBP1-83133] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SPINK2 Antibody [NBP1-83133] - Staining in human epididymis and kidney tissues using anti-SPINK2 antibody. Corresponding SPINK2 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

SPINK2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
Specificity of human SPINK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPINK2 Protein (NBP1-83133PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SPINK2 Antibody

  • Acrosin-trypsin inhibitor
  • Kazal type 2 (acrosin-trypsin inhibitor)
  • serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor)
  • serine protease inhibitor Kazal-type 2
  • serine protease inhibitor, Kazal type, 2 (acrosin-trypsin inhibitor)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SPINK2 Antibody (NBP1-83133) (0)

There are no publications for SPINK2 Antibody (NBP1-83133).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPINK2 Antibody (NBP1-83133) (0)

There are no reviews for SPINK2 Antibody (NBP1-83133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPINK2 Antibody (NBP1-83133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SPINK2 Products

Bioinformatics Tool for SPINK2 Antibody (NBP1-83133)

Discover related pathways, diseases and genes to SPINK2 Antibody (NBP1-83133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPINK2 Antibody (NBP1-83133)

Discover more about diseases related to SPINK2 Antibody (NBP1-83133).

Pathways for SPINK2 Antibody (NBP1-83133)

View related products by pathway.

PTMs for SPINK2 Antibody (NBP1-83133)

Learn more about PTMs related to SPINK2 Antibody (NBP1-83133).

Blogs on SPINK2

There are no specific blogs for SPINK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPINK2 Antibody and receive a gift card or discount.


Gene Symbol SPINK2