SPIN2A Antibody - BSA Free

Western Blot: SPIN2A Antibody [NBP2-83592] - Host: Rabbit. Target Name: SPIN2A. Sample Tissue: Human COLO205 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SPIN2A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPIN2A Antibody - BSA Free (NBP2-83592) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human SPIN2A. Peptide sequence: NMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKGTVLDQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPIN2A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SPIN2A Antibody - BSA Free

• centromeric spin2 copy
• DXF34dJ323P24.1
• MGC88670
• Protein DXF34
• RP3-323P24.2
• SPIN2
• SPIN-2
• SPIN-2A
• spindlin family, member 2
• spindlin family, member 2A
• spindlin homolog 2
• spindlin-2A
• spindlin-like protein 2
• Spindlin-like protein 2A

Background

The SPIN2A gene encodes one of three members of the DXF34 gene family, located in a 100-kb region of chromosome Xp11.21. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPIN2A