SPIN1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SPIN1. Peptide sequence: YQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKR The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SPIN1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for SPIN1 Antibody - BSA Free
Background
SPIN1 may play a role in cell-cycle regulation during the transition from gamete to embryo
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, IHC
Publications for SPIN1 Antibody (NBP2-83590) (0)
There are no publications for SPIN1 Antibody (NBP2-83590).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SPIN1 Antibody (NBP2-83590) (0)
There are no reviews for SPIN1 Antibody (NBP2-83590).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SPIN1 Antibody (NBP2-83590) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SPIN1 Products
Research Areas for SPIN1 Antibody (NBP2-83590)
Find related products by research area.
|
Blogs on SPIN1