SPICE1 Antibody

Images

 
Western Blot: SPICE1 Antibody [NBP1-70712] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: SPICE1 Antibody [NBP1-70712] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
Western Blot: SPICE1 Antibody [NBP1-70712] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPICE1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CCDC52(coiled-coil domain containing 52) The peptide sequence was selected from the middle region of CCDC52 (NP_653319). Peptide sequence KEQNWEEKTLPIDTDIQNSSEENRLFTQRWRVSHMGEDLENKTQAPFVNL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPICE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
96 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPICE1 Antibody

  • CCDC52
  • FLJ26064
  • SPICE
  • spindle and centriole associated protein 1

Background

The specific function of CCDC52 is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF4779
Species: Hu
Applications: WB, IHC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF2009
Species: Hu
Applications: WB, IHC
NBP2-14243
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86241
Species: Hu
Applications: WB, IHC, IHC-P
AF7177
Species: Hu
Applications: WB, ICC
AF5659
Species: Hu
Applications: WB
AF5540
Species: Mu
Applications: WB
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for SPICE1 Antibody (NBP1-70712) (0)

There are no publications for SPICE1 Antibody (NBP1-70712).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPICE1 Antibody (NBP1-70712) (0)

There are no reviews for SPICE1 Antibody (NBP1-70712). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPICE1 Antibody (NBP1-70712) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPICE1 Products

Bioinformatics Tool for SPICE1 Antibody (NBP1-70712)

Discover related pathways, diseases and genes to SPICE1 Antibody (NBP1-70712). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPICE1

There are no specific blogs for SPICE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPICE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPICE1
Entrez
Uniprot