SPHKAP Antibody

Images

 
Immunohistochemistry: SPHKAP Antibody [NBP2-30770] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPHKAP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PSAKPSQWKREAVGNGRQATHYYHSEAFKGQMEKSQALYIPKDAYFSMMDKDVPSACAVAEQRSNLNPGDHEDTRNALPPRQDGEVTTGKY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPHKAP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPHKAP Protein (NBP2-30770PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPHKAP Antibody

  • A-kinase anchor protein SPHKAP
  • SKIP
  • sphingosine kinase type 1-interacting protein
  • SPHK1 (sphingosine kinase type 1) interacting protein
  • SPHK1 interactor, AKAP domain containing
  • SPHK1-interactor and AKAP domain-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4079
Species: Hu
Applications: WB, ICC
27550002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
H00003636-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
H00008877-M01
Species: Hu
Applications: WB, ELISA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-30770
Species: Hu
Applications: IHC, IHC-P

Publications for SPHKAP Antibody (NBP2-30770) (0)

There are no publications for SPHKAP Antibody (NBP2-30770).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPHKAP Antibody (NBP2-30770) (0)

There are no reviews for SPHKAP Antibody (NBP2-30770). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPHKAP Antibody (NBP2-30770) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPHKAP Products

Bioinformatics Tool for SPHKAP Antibody (NBP2-30770)

Discover related pathways, diseases and genes to SPHKAP Antibody (NBP2-30770). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPHKAP Antibody (NBP2-30770)

Discover more about diseases related to SPHKAP Antibody (NBP2-30770).
 

Pathways for SPHKAP Antibody (NBP2-30770)

View related products by pathway.

PTMs for SPHKAP Antibody (NBP2-30770)

Learn more about PTMs related to SPHKAP Antibody (NBP2-30770).

Blogs on SPHKAP

There are no specific blogs for SPHKAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPHKAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPHKAP
Uniprot