SHIP2/INPPL1 Antibody (3E6)

Images

 
Western Blot: SHIP2/INPPL1 Antibody (3E6) [H00003636-M01] - INPPL1 monoclonal antibody (M01), clone 3E6 Analysis of INPPL1 expression in HeLa.
ELISA: SHIP2/INPPL1 Antibody (3E6.) [H00003636-M01] - SHIP2/INPPL1 Antibody (3E6) [H00003636-M01] - Detection limit for recombinant GST tagged INPPL1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SHIP2/INPPL1 Antibody (3E6) Summary

Immunogen
INPPL1 (NP_001558 1159 a.a. - 1258 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Localization
Cytoplasmic and peripheral membrane
Specificity
INPPL1 - inositol polyphosphate phosphatase-like 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
INPPL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA. ICC/IF usage was reported in scientific literature.
Control
SHIP2/INPPL1 Knockout HeLa Cell Lysate
Reviewed Applications
Read 1 Review rated 4
using
H00003636-M01 in the following applications:

Publications
Read Publications using
H00003636-M01 in the following applications:

  • 6 publications
  • WB
    4 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SHIP2/INPPL1 Antibody (3E6)

  • EC 3.1.3
  • EC 3.1.3.n1
  • inositol polyphosphate phosphatase-like 1
  • Inositol polyphosphate phosphatase-like protein 1
  • INPPL1
  • INPPL-1
  • phosphatidylinositol-34,5-trisphosphate 5-phosphatase 2
  • Protein 51C
  • SH2 domain-containing inositol phosphatase 2
  • SH2 domain-containing inositol-5'-phosphatase 2
  • SHIP2
  • SHIP-2
  • SHIP251C protein

Background

INPPL1 is a phosphatidylinositol (PtdIns) phosphatase that specifically hydrolyzes the 5-phosphate of phosphatidylinositol-3,4,5-trisphosphate (PtdIns(3,4,5)P3) to produce PtdIns(3,4)P2, thereby negatively regulating the PI3K (phosphoinositide 3-kinase) pathways with wide reaching effects It plays a central role in regulation of PI3K-dependent insulin signaling and confers resistance to dietary obesity. It is part of a signaling pathway that regulates actin cytoskeleton remodeling. It regulates cell adhesion and cell spreading and acts as a regulator of neuritogenesis. It acts as a negative regulator of the FC-gamma-RIIA receptor (FCGR2A). and mediates signaling from the FC-gamma-RIIB receptor (FCGR2B), playing a central role in terminating signal transduction from activating immune/hematopoietic cell receptor systems. It is involved in the EGF signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2317
Species: Hu, Mu, Rt
Applications: WB, ICC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
NBP2-67321
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-65538
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP2-38535
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55408
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46411
Species: Hu
Applications: WB, IHC
AF5129
Species: Hu
Applications: WB
H00003636-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for SHIP2/INPPL1 Antibody (H00003636-M01)(8)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(6)
WB
(4)
All Applications
Filter By Species
Human
(7)
All Species
Showing Publications 1 - 8 of 8.
Publications using H00003636-M01 Applications Species
Ramos AR, Ghosh S, Dedobbeleer M et al. Lipid phosphatases SKIP and SHIP2 regulate fibronectin-dependent cell migration in glioblastoma FEBS J. Jan 29 2019 [PMID: 30695232] (ICC/IF, Human) ICC/IF Human
Ramos AR, Ghosh S, Erneux C. The impact of PI 5-phosphatases on phosphoinositides in cell function and human disease. J. Lipid Res. Sep 7 2018 [PMID: 30194087] (ICC/IF, Human) ICC/IF Human
Chan Wah Hak L, Khan S, Di Meglio I et al. FBP17 and CIP4 recruit SHIP2 and lamellipodin to prime the plasma membrane for fast endophilin-mediated endocytosis Nat. Cell Biol. Sep 1 2018 [PMID: 30061681] (WB, ICC/IF, Human) WB, ICC/IF Human
Edimo WE, Ramos AR, Ghosh S et al. The SHIP2 interactor Myo1c is required for cell migration in 1321 N1 glioblastoma cells. Biochem. Biophys. Res. Commun. May 28 2016 [PMID: 27246739] (WB, ICC/IF, Human) WB, ICC/IF Human
Edimo WE, Ghosh S, Derua R et al. SHIP2 controls plasma membrane PI(4,5)P2 thereby participating in the control of cell migration in 1321 N1 glioblastoma. J. Cell. Sci. 2016 Jan 29 [PMID: 26826186] (WB, Human) WB Human
Deneubourg L, Elong Edimo W, Moreau C et al. Phosphorylated SHIP2 on Y1135 localizes at focal adhesions and at the mitotic spindle in cancer cell lines. Cell. Signal. 2014 Mar 03 [PMID: 24561238] (ICC/IF, WB, Human) ICC/IF, WB Human
Elong Edimo W, Vanderwinden JM, Erneux C. SHIP2 signalling at the plasma membrane, in the nucleus and at focal contacts Adv Biol Regul 2012 Sep 13 [PMID: 23040614] (ICC/IF, Human) ICC/IF Human
McNulty S, Powell K, Erneux C, Kalman D. The Host Phosphoinositide 5-Phosphatase SHIP2 Regulates Dissemination of Vaccinia Virus. J Virol;85(14):7402-7410. 2011 Jul. [PMID: 21543482]

Review for SHIP2/INPPL1 Antibody (H00003636-M01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using H00003636-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot SHIP2/INPPL1 H00003636-M01
Enlarge
reviewed by:
Cedric Asensio
WB Rat 11/01/2017
View

Summary

ApplicationWestern Blot
Sample TestedPC12 cell lysate
SpeciesRat
LotGA061-3E6

Comments

CommentsUsed Ab in PBS-T Milk @1:200. Using Goat-Anti-Mouse-HRP as secondary.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SHIP2/INPPL1 Antibody (H00003636-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SHIP2/INPPL1 Products

Bioinformatics Tool for SHIP2/INPPL1 Antibody (H00003636-M01)

Discover related pathways, diseases and genes to SHIP2/INPPL1 Antibody (H00003636-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SHIP2/INPPL1 Antibody (H00003636-M01)

Discover more about diseases related to SHIP2/INPPL1 Antibody (H00003636-M01).
 

Pathways for SHIP2/INPPL1 Antibody (H00003636-M01)

View related products by pathway.

PTMs for SHIP2/INPPL1 Antibody (H00003636-M01)

Learn more about PTMs related to SHIP2/INPPL1 Antibody (H00003636-M01).
 

Research Areas for SHIP2/INPPL1 Antibody (H00003636-M01)

Find related products by research area.

Blogs on SHIP2/INPPL1

There are no specific blogs for SHIP2/INPPL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Cedric Asensio
11/01/2017
Application: WB
Species: Rat

Bioinformatics

Gene Symbol INPPL1
Entrez
OMIM
Uniprot