Sphingosine Kinase 2/SPHK2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Sphingosine Kinase 2/SPHK2 Antibody [NBP2-57035] - Staining of human cell line SH-SY5Y shows localization to vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sphingosine Kinase 2/SPHK2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LTCLLRGLPLPGDGEITPDLLPRPPRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPHK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Sphingosine Kinase 2/SPHK2 Recombinant Protein Antigen (NBP2-57035PEP)

Reactivity Notes

Mouse 86%, Rat 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Sphingosine Kinase 2/SPHK2 Antibody - BSA Free

• EC 2.7.1.91
• SK 2
• SK2
• sphingosine kinase 2
• sphingosine kinase type 2 isoform
• SPHK2
• SPK 2
• SPK2

Background

SPHK2 catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPHK2