Spermine synthase Antibody

Images

 
Western Blot: Spermine synthase Antibody [NBP1-87813] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: Spermine synthase Antibody [NBP1-87813] - Staining of human ovary shows strong cytoplasmic positivity in follicle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Spermine synthase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Spermine synthase Protein (NBP1-87813PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Spermine synthase Antibody

  • EC 2.5.1.22
  • MRSRSpS
  • Snyder-Robinson X-linked mental retardation syndrome
  • Spermidine aminopropyltransferase
  • spermine synthase
  • SPMSYSRS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-80726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-92435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-87813
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Spermine synthase Antibody (NBP1-87813) (0)

There are no publications for Spermine synthase Antibody (NBP1-87813).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Spermine synthase Antibody (NBP1-87813) (0)

There are no reviews for Spermine synthase Antibody (NBP1-87813). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Spermine synthase Antibody (NBP1-87813) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Spermine synthase Products

Bioinformatics Tool for Spermine synthase Antibody (NBP1-87813)

Discover related pathways, diseases and genes to Spermine synthase Antibody (NBP1-87813). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Spermine synthase Antibody (NBP1-87813)

Discover more about diseases related to Spermine synthase Antibody (NBP1-87813).
 

Pathways for Spermine synthase Antibody (NBP1-87813)

View related products by pathway.

PTMs for Spermine synthase Antibody (NBP1-87813)

Learn more about PTMs related to Spermine synthase Antibody (NBP1-87813).
 

Research Areas for Spermine synthase Antibody (NBP1-87813)

Find related products by research area.

Blogs on Spermine synthase

There are no specific blogs for Spermine synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Spermine synthase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMS