Spermine synthase Antibody (1U7C7)

Western Blot: Spermine synthase Antibody (1U7C7) [NBP3-33548] - Western blot analysis of various lysates using at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Western Blot: Spermine synthase Antibody (1U7C7) [NBP3-33548] - Western blot analysis of various lysates using at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 1U7C7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Spermine synthase Antibody (1U7C7) Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Spermine synthase (P52788).
  
  Sequence:
  TYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNI
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SMS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Spermine synthase Antibody (1U7C7)

• EC 2.5.1.22
• MRSRSpS
• Snyder-Robinson X-linked mental retardation syndrome
• Spermidine aminopropyltransferase
• spermine synthase
• SPMSYSRS

Background

Spermine synthase is 1 of 4 enzymes involved in the synthesis of polyamines from arginine and methionine. The reaction catalysed is S-adenosylmethioninamine + spermidine = methylthioadenosine + spermine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMS