Recombinant Human Spectrin beta 3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Spectrin beta 3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 643-720 of Human Spectrin beta 3

Source: Wheat Germ

Amino Acid Sequence: LWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SPTBN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
34.32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Spectrin beta 3 Protein

  • beta-III Spectrin
  • glutamate transporter EAAT4-associated protein 41
  • GTRAP41
  • KIAA0302
  • SCA5
  • SCAR14
  • Spectrin beta 3
  • spectrin beta chain, brain 2
  • Spectrin beta III
  • spectrin, beta, non-erythrocytic 2
  • Spectrin, non-erythroid beta chain 2
  • spinocerebellar ataxia 5
  • SPTBN2

Background

SPTBN2 - spectrin, beta, non-erythrocytic 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-51689
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56984
Species: Hu
Applications: ICC/IF
NBP2-48740
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52176
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-92476
Species: Hu
Applications: IHC, IHC-P
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58916
Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-55745
Species: Hu
Applications: ICC/IF
H00003748-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NBP1-84938
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49081
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Spectrin beta 3 Partial Recombinant Protein (H00006712-Q01) (0)

There are no publications for Spectrin beta 3 Partial Recombinant Protein (H00006712-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Spectrin beta 3 Partial Recombinant Protein (H00006712-Q01) (0)

There are no reviews for Spectrin beta 3 Partial Recombinant Protein (H00006712-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Spectrin beta 3 Partial Recombinant Protein (H00006712-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Spectrin beta 3 Products

Bioinformatics Tool for Spectrin beta 3 Partial Recombinant Protein (H00006712-Q01)

Discover related pathways, diseases and genes to Spectrin beta 3 Partial Recombinant Protein (H00006712-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Spectrin beta 3 Partial Recombinant Protein (H00006712-Q01)

Discover more about diseases related to Spectrin beta 3 Partial Recombinant Protein (H00006712-Q01).
 

Pathways for Spectrin beta 3 Partial Recombinant Protein (H00006712-Q01)

View related products by pathway.

PTMs for Spectrin beta 3 Partial Recombinant Protein (H00006712-Q01)

Learn more about PTMs related to Spectrin beta 3 Partial Recombinant Protein (H00006712-Q01).
 

Research Areas for Spectrin beta 3 Partial Recombinant Protein (H00006712-Q01)

Find related products by research area.

Blogs on Spectrin beta 3

There are no specific blogs for Spectrin beta 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Spectrin beta 3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPTBN2
Entrez