SPDEF Antibody

Images

 
Western Blot: SPDEF Antibody [NBP1-74237] - Human Fetal Muscle Cell Lysate, concentration 1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPDEF Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of SPDEF. Immunizing peptide sequence FKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPDEF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SPDEF and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPDEF Antibody

  • bA375E1.3
  • PDEFRP11-375E1__A.3
  • Prostate epithelium-specific Ets transcription factor
  • Prostate-derived Ets factor
  • Prostate-specific Ets
  • PSE
  • SAM pointed domain containing ets transcription factor
  • SAM pointed domain-containing Ets transcription factor

Background

PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-87962
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-58560
Species: Hu
Applications: ICC/IF
NBP1-87780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-57713
Species: Hu
Applications: WB, ICC/IF
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF

Publications for SPDEF Antibody (NBP1-74237) (0)

There are no publications for SPDEF Antibody (NBP1-74237).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPDEF Antibody (NBP1-74237) (0)

There are no reviews for SPDEF Antibody (NBP1-74237). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPDEF Antibody (NBP1-74237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPDEF Products

Bioinformatics Tool for SPDEF Antibody (NBP1-74237)

Discover related pathways, diseases and genes to SPDEF Antibody (NBP1-74237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPDEF Antibody (NBP1-74237)

Discover more about diseases related to SPDEF Antibody (NBP1-74237).
 

Pathways for SPDEF Antibody (NBP1-74237)

View related products by pathway.

PTMs for SPDEF Antibody (NBP1-74237)

Learn more about PTMs related to SPDEF Antibody (NBP1-74237).

Blogs on SPDEF

There are no specific blogs for SPDEF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPDEF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPDEF
Uniprot