SPDEF Antibody


Western Blot: SPDEF Antibody [NBP1-74237] - Human Fetal Muscle Cell Lysate, concentration 1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SPDEF Antibody Summary

Synthetic peptides corresponding to the C terminal of SPDEF. Immunizing peptide sequence FKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SPDEF and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPDEF Antibody

  • bA375E1.3
  • PDEFRP11-375E1__A.3
  • Prostate epithelium-specific Ets transcription factor
  • Prostate-derived Ets factor
  • Prostate-specific Ets
  • PSE
  • SAM pointed domain containing ets transcription factor
  • SAM pointed domain-containing Ets transcription factor


PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ChIP, ICC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF

Publications for SPDEF Antibody (NBP1-74237) (0)

There are no publications for SPDEF Antibody (NBP1-74237).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPDEF Antibody (NBP1-74237) (0)

There are no reviews for SPDEF Antibody (NBP1-74237). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPDEF Antibody (NBP1-74237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SPDEF Products

Bioinformatics Tool for SPDEF Antibody (NBP1-74237)

Discover related pathways, diseases and genes to SPDEF Antibody (NBP1-74237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPDEF Antibody (NBP1-74237)

Discover more about diseases related to SPDEF Antibody (NBP1-74237).

Pathways for SPDEF Antibody (NBP1-74237)

View related products by pathway.

PTMs for SPDEF Antibody (NBP1-74237)

Learn more about PTMs related to SPDEF Antibody (NBP1-74237).

Blogs on SPDEF

There are no specific blogs for SPDEF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPDEF Antibody and receive a gift card or discount.


Gene Symbol SPDEF