SPATA6 Antibody

Images

 
Western Blot: SPATA6 Antibody [NBP1-70710] - Sample Tissue: Human HCT116 Antibody Dilution: 1.0 ug/ml
Western Blot: SPATA6 Antibody [NBP1-70710] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPATA6 Antibody Summary

Immunogen
Synthetic peptides corresponding to SPATA6(spermatogenesis associated 6) The peptide sequence was selected from the middle region of SPATA6. Peptide sequence SQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPATA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SPATA6 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SPATA6 Antibody

  • HASH
  • spermatogenesis associated 6

Background

SPATA6 belongs to the SPATA6 family. SPATA6 may play a role in spermatid maturation or sperm function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-12553
Species: Hu
NBP2-46466
Species: Hu
Applications: IHC
NBP2-19819
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for SPATA6 Antibody (NBP1-70710) (0)

There are no publications for SPATA6 Antibody (NBP1-70710).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA6 Antibody (NBP1-70710) (0)

There are no reviews for SPATA6 Antibody (NBP1-70710). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPATA6 Antibody (NBP1-70710) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPATA6 Products

Bioinformatics Tool for SPATA6 Antibody (NBP1-70710)

Discover related pathways, diseases and genes to SPATA6 Antibody (NBP1-70710). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for SPATA6 Antibody (NBP1-70710)

View related products by pathway.

Blogs on SPATA6

There are no specific blogs for SPATA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPATA6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATA6