SPATA13 Antibody

Images

 
Western Blot: SPATA13 Antibody [NBP1-90848] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: SPATA13 Antibody [NBP1-90848] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPATA13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NQKKLAMLNAQKAGHGKSKGYNRCPVAPPHQGLHPIHQRHITMPTSVPQQQVFGLAEPKRKSSLFWHTFNRLT
Specificity
Specificity of human SPATA13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPATA13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPATA13 Antibody

  • adenomatous polyposis coli stimulated exchange factor 2
  • FLJ35435
  • spermatogenesis associated 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1316
Species: Hu
Applications: WB, PEP-ELISA
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-67091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-30981
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-80917
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PEP-ELISA
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
7270-IL/CF
Species: Hu
AF6260
Species: Hu
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-58359
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
NBP1-90848
Species: Hu
Applications: WB, ICC/IF

Publications for SPATA13 Antibody (NBP1-90848) (0)

There are no publications for SPATA13 Antibody (NBP1-90848).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA13 Antibody (NBP1-90848) (0)

There are no reviews for SPATA13 Antibody (NBP1-90848). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPATA13 Antibody (NBP1-90848) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPATA13 Products

Bioinformatics Tool for SPATA13 Antibody (NBP1-90848)

Discover related pathways, diseases and genes to SPATA13 Antibody (NBP1-90848). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPATA13 Antibody (NBP1-90848)

Discover more about diseases related to SPATA13 Antibody (NBP1-90848).
 

Pathways for SPATA13 Antibody (NBP1-90848)

View related products by pathway.

Blogs on SPATA13

There are no specific blogs for SPATA13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPATA13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATA13