SPAG1 Antibody - BSA Free

Immunohistochemistry-Paraffin: SPAG1 Antibody [NBP2-38707] - Staining in human testis and prostate tissues using anti-SPAG1 antibody. Corresponding SPAG1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SPAG1 Antibody [NBP2-38707] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: SPAG1 Antibody [NBP2-38707] - Staining of human prostate shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPAG1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPAG1 Antibody - BSA Free (NBP2-38707) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KKTPRDYAEWDKFDVEKECLKIDEDYKEKTVIDKSHLSKIETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPAG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SPAG1 Protein (NBP2-38707PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SPAG1 Antibody - BSA Free

• FLJ32920
• HSD-3.8sperm-associated antigen 1
• Infertility-related sperm protein Spag-1
• SP75
• sperm associated antigen 1
• tetratricopeptide repeat-containing protein
• TPIS
• TPR-containing protein involved in spermatogenesis

Background

The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm agglutinating antibodies from an infertile woman. Furthermore, immunization of female rats with the recombinant human protein reduced fertility. This protein localizes to the plasma membrane of germ cells in the testis and to the post-acrosomal plasma membrane of mature spermatozoa. Recombinant polypeptide binds GTP and exhibits GTPase activity. Thus, this protein may regulate GTP signal transduction pathways involved in spermatogenesis and fertilization. Two transcript variants of this gene encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPAG1
• Uniprot:
  • Q07617(Human)