SPACA1 Antibody - BSA Free

Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP1-80792] - Staining in human testis and endometrium tissues using anti-SPACA1 antibody. Corresponding SPACA1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP1-80792] - Staining of human cerebral cortex, kidney, liver and testis using Anti-SPACA1 antibody NBP1-80792 (A) shows similar protein distribution across tissues to independent antibody NBP2-38506 (B).

Western Blot: SPACA1 Antibody [NBP1-80792] - Analysis in control (vector only transfected HEK293T lysate) and SPACA1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP1-80792] - Staining of human Liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP1-80792] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP1-80792] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP1-80792] - Staining of human liver.

Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP1-80792] - Staining of human kidney.

Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP1-80792] - Analysis in human testis and liver tissues using NBP1-80792 antibody. Corresponding SPACA1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP1-80792] - Staining of human Cerebral cortex shows no positivity in neuronal cells as expected.

Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP1-80792] - Staining of human cerebral cortex, kidney, liver and testis using Anti-SPACA1 antibody NBP1-80792 (A) shows similar protein distribution across tissues to independent antibody NBP2-38506 (B).

Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP1-80792] - Staining of human Kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: SPACA1 Antibody [NBP1-80792] - Staining of human Testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SPACA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SPACA1 Antibody - BSA Free (NBP1-80792) is a polyclonal antibody validated for use in IHC and WB. Anti-SPACA1 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: REVILTNGCPGGESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNRFKYMWKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPACA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SPACA1 Protein (NBP1-80792PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SPACA1 Antibody - BSA Free

• MGC32952
• SAMP32
• sperm acrosomal membrane-associated protein 32
• sperm acrosome associated 1
• sperm acrosome membrane-associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPACA1 Antibody (NBP1-80792)(4)

Publications using NBP1-80792

• Tesfay L, Paul BT, Hegde P et al. Complementary anti-cancer pathways triggered by inhibition of sideroflexin 4 in ovarian cancer Scientific reports 2022-11-19 [PMID: 36402786]
• Imam KMSU, Tian Y, Xin F et al. Lactucin, a Bitter Sesquiterpene from Cichorium intybus, Inhibits Cancer Cell Proliferation by Downregulating the MAPK and Central Carbon Metabolism Pathway Molecules (Basel, Switzerland) 2022-10-29 [PMID: 36364182] (WB, Human)
• Streichemberger E, Perrin J, Saias-Magnan J et al. Case report of apoptosis in testis of four AZFc-deleted patients: increased DNA fragmentation during meiosis, but decreased apoptotic markers in post-meiotic germ cells. Hum Reprod 2012-07-01 [PMID: 22508792]
• Longepied G, Saut N, Aknin-Seifer I et al. Complete deletion of the AZFb interval from the Y chromosome in an oligozoospermic man. Hum Reprod 2010-10-01 [PMID: 20716563]

Bioinformatics

• Gene Symbol: SPACA1
• Entrez:
  • 81833(Human)
• Uniprot:
  • Q9HBV2(Human)