![Immunocytochemistry/Immunofluorescence: SP8 Antibody [NBP2-49109] - Staining of human cell line PC-3 shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/SP8-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49109-img0003.jpg "Immunocytochemistry/Immunofluorescence: SP8 Antibody [NBP2-49109] - Staining of human cell line PC-3 shows localization to nucleus. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HPYESWFKPSHPGLGAAGEVGSAGASSWWDVGAGWIDVQNPNSA |
| Specificity | Specificity of human SP8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SP8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-49109 | Applications | Species |
|---|---|---|
| Borrett MJ, Innes BT, Jeong D et al. Single-Cell Profiling Shows Murine Forebrain Neural Stem Cells Reacquire a Developmental State when Activated for Adult Neurogenesis Cell Rep Aug 11 2020 [PMID: 32783944] (IHC, Mouse) | IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
Diseases for SP8 Antibody (NBP2-49109)Discover more about diseases related to SP8 Antibody (NBP2-49109).
| Pathways for SP8 Antibody (NBP2-49109)View related products by pathway.
|
PTMs for SP8 Antibody (NBP2-49109)Learn more about PTMs related to SP8 Antibody (NBP2-49109).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SP8 |
![Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize2/SP8-Antibody-Immunohistochemistry-Paraffin-NBP2-49109-img0008.jpg "Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize2/SP8-Antibody-Immunohistochemistry-Paraffin-NBP2-49109-img0005.jpg "Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human placenta shows no positivity in trophoblastic cells as expected.")
![Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human prostate shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize2/SP8-Antibody-Immunohistochemistry-Paraffin-NBP2-49109-img0006.jpg "Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human prostate shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize2/SP8-Antibody-Immunohistochemistry-Paraffin-NBP2-49109-img0007.jpg "Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
![Western Blot: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DAND5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DAND5.](http://images.novusbio.com/images/DAND5 Antibody (2H3)-Western Blot-NBP2-01223-img0002.jpg)
![Immunohistochemistry-Paraffin: DAND5 Antibody (2H3) [NBP2-01223] Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-DAND5 mouse monoclonal antibody.](http://images.novusbio.com/images/DAND5 Antibody (2H3)-Immunohistochemistry-Paraffin-NBP2-01223-img0005.jpg)
![Flow Cytometry: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DAND5 antibody, and then analyzed by flow cytometry.](http://images.novusbio.com/images/DAND5 Antibody (2H3)-Flow Cytometry-NBP2-01223-img0001.jpg)
![Western Blot: SP1 Antibody [NB600-233] - Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse Renca cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SP1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.](http://images.novusbio.com/images2/SP1-Antibody-Western-Blot-NB600-233-img0007.jpg)
![Immunohistochemistry-Paraffin: SP1 Antibody [NB600-233] - Mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-SP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB](http://images.novusbio.com/images2/SP1-Antibody-Immunohistochemistry-Paraffin-NB600-233-img0009.jpg)
![Chromatin Immunoprecipitation: SP1 Antibody [NB600-233] - Chromatin from acute myeloid leukemia cell line was immunoprecipitated with anti-Sp1 antibody and analyzed by DNA sequencing. The figure illustrates the peak distribution of Sp1 binding within a 250 Kb region of chromosome 6 asdetected using anti-Sp1.](http://images.novusbio.com/images2/SP1-Antibody-Chromatin-Immunoprecipitation-NB600-233-img0014.jpg)
![Western Blot: SP6 Antibody [NBP1-92428] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/SP6-Antibody-Western-Blot-NBP1-92428-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: SP6 Antibody [NBP1-92428] - Staining of human cell line CACO-2 shows localization to nucleoplasm, centrosome & mitotic spindle. Antibody staining is shown in green.](http://images.novusbio.com/images2/SP6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92428-img0004.jpg)
![Western Blot: Pax6 Antibody [NB300-750] - Analysis of sheep retinal extract](http://images.novusbio.com/images2/Pax6-Antibody-Western-Blot-NB300-750-img0023.jpg)
![Immunocytochemistry/Immunofluorescence: Pax6 Antibody [NB300-750] - ARPE-19 monolayer on glass substrate. Fixative Methanol Blocking Goat Serum. Dilution 1:100. Incubation 1h @ RT. This image was submitted via customer Review.](http://images.novusbio.com/images2/Pax6 Antibody-Immunocytochemistry-NB300-750-img0024.jpg)
![Western Blot: Pax6 Antibody [NB300-750] - Analysis of rat whole eye extract](http://images.novusbio.com/images2/Pax6-Antibody-Western-Blot-NB300-750-img0017.jpg)
![Western Blot: EMX2 Antibody [NBP2-39052] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://images.novusbio.com/images2/EMX2-Antibody-Western-Blot-NBP2-39052-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: EMX2 Antibody [NBP2-39052] - Staining of human cell line RH-30 shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/images2/EMX2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39052-img0003.jpg)
![Immunohistochemistry-Paraffin: EMX2 Antibody [NBP2-39052] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/images2/EMX2-Antibody-Immunohistochemistry-Paraffin-NBP2-39052-img0006.jpg)
![Western Blot: Calretinin Antibody [NBP1-88220] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/images2/Calretinin-Antibody-Western-Blot-NBP1-88220-img0018.jpg)
![Immunocytochemistry/Immunofluorescence: Calretinin Antibody [NBP1-88220] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/Calretinin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88220-img0011.jpg)
![Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining in human testis and skeletal muscle tissues using NBP1-88220 antibody. Corresponding CALB2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Calretinin-Antibody-Immunohistochemistry-Paraffin-NBP1-88220-img0024.jpg)
![Immunocytochemistry/Immunofluorescence: SP9 Antibody [NBP2-38967] - Staining of human cell line A549 shows localization to nucleus & mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/images2/SP9-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38967-img0003.jpg)
![Immunohistochemistry-Paraffin: SP9 Antibody [NBP2-38967] - Staining of human stomach shows no positivity in glandular cells as expected.](http://images.novusbio.com/images2/SP9-Antibody-Immunohistochemistry-Paraffin-NBP2-38967-img0008.jpg)
![Immunohistochemistry-Paraffin: SP9 Antibody [NBP2-38967] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.](http://images.novusbio.com/images2/SP9-Antibody-Immunohistochemistry-Paraffin-NBP2-38967-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Sp5 Antibody [NBP2-56340] - Staining of human cell line Hep G2 shows localization to nucleus & nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/images2/Sp5 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-56340-img0001.jpg)
![Western Blot: SP4 Antibody [NBP2-97665] - Anti-SP4 rabbit polyclonal antibody at 1:500 dilution. Lane A: Hela Whole Cell Lysate Lane B: Jurkat Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 82 kDa. Observed band size: 97 kDa](http://images.novusbio.com/images2/SP4-Antibody-Western-Blot-NBP2-97665-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: SP4 Antibody [NBP2-97665] - Immunofluorescence staining of SP4 in U251MG cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS, blocked with 10% serum, and incubated with rabbit anti-Human SP4 polyclonal antibody (dilution ratio 1:200) at 4C overnight. Then cells were stained with the Alexa Fluor(R)488-conjugated Goat Anti-rabbit IgG secondary antibody (green). Positive staining was localized to Nucleus.](http://images.novusbio.com/images2/SP4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-97665-img0001.jpg)
![Immunohistochemistry-Paraffin: SP4 Antibody [NBP2-97665] - Immunochemical staining of human SP4 in human spleen with rabbit polyclonal antibody at 1:300 dilution, formalin-fixed paraffin embedded sections.](http://images.novusbio.com/images2/SP4-Antibody-Immunohistochemistry-Paraffin-NBP2-97665-img0004.jpg)
![Western Blot: Prosurfactant Protein C Antibody [NBP1-87201] - Analysis in human lung tissue.](http://images.novusbio.com/images2/Prosurfactant-Protein-C-Antibody-Western-Blot-NBP1-87201-img0005.jpg)
![Immunohistochemistry-Paraffin: Prosurfactant Protein C Antibody [NBP1-87201] - Analysis in human lung and kidney tissues using HPA010928 antibody. Corresponding SFTPC RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Prosurfactant-Protein-C-Antibody-Immunohistochemistry-Paraffin-NBP1-87201-img0008.jpg)
![Immunohistochemistry-Paraffin: Prosurfactant Protein C Antibody [NBP1-87201] - Staining of human kidney shows no positivity in cells in glomeruli as expected.](http://images.novusbio.com/images2/Prosurfactant-Protein-C-Antibody-Immunohistochemistry-Paraffin-NBP1-87201-img0006.jpg)
![Western Blot: csl/RBPJK Antibody [NBP1-33427] - Sample (30 ug of whole cell lysate) A: Jurkat 7.5% SDS PAGE diluted at 1:2000](http://images.novusbio.com/images2/csl-RBPJK-Antibody-Western-Blot-NBP1-33427-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: csl/RBPJK Antibody [NBP1-33427] - Analysis of paraformaldehyde-fixed HeLa at 1:100 dilution.](http://images.novusbio.com/images2/csl-RBPJK-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-33427-img0004.jpg)
![Chromatin Immunoprecipitation (ChIP): csl/RBPJK Antibody [NBP1-33427] - Sheared, cross-linked chromatin was prepared from Jurkat T-ALL cells using the Covaris TruChIP kit and shearing with the LE220 sonicator. The chromatin buffer was adjusted to 150 mM NaCl, 20 mM Tris-Cl pH 8, 2 mM EDTA, and 1% Triton X-100. Three antibodies, as well as pure pre-immune rabbit IgG control, were added to each IP reaction, consisting of 7 million cells, and incubated overnight with mixing at 4 C. The antibodies were captured with Magna ChIP Protein A+G beads (Millipore), washed with three wash buffers, and the DNA eluted and purified with the iPure v2 kit (Diagenode). The purified DNA was normalized to the input control with qPCR quantification of the insulin exon 1 gene (INS) and an RBPJ binding site in the promoter of HES1. Image from verified customer review.](http://images.novusbio.com/images2/csl-RBPJK-Antibody-Chromatin-Immunoprecipitation-(ChIP)-NBP1-33427-img0006.jpg)
![Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Tyrosine-Hydroxylase-Antibody-Immunohistochemistry-NB300-109-img0029.jpg)
![Immunocytochemistry/Immunofluorescence: Tyrosine Hydroxylase Antibody [NB300-109] - Dopamine neurons in the mouse substantia nigra. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/images2/Tyrosine-Hydroxylase-Antibody-Immunocytochemistry-Immunofluorescence-NB300-109-img0007.jpg)
![Simple Western: Tyrosine Hydroxylase Antibody [NB300-109] - Simple Western lane view shows a specific band for Tyrosine Hydroxylase in 0.2 mg/mL of PC-12 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/images2/Tyrosine-Hydroxylase-Antibody-Simple-Western-NB300-109-img0008.jpg)
![Western Blot: GSH2 Antibody [NBP2-43705] - Analysis of A. 30 ug IMR32 whole cell lysate/extract 12 % SDS-PAGE GSX2 antibody dilution: 1:500.](http://images.novusbio.com/images2/GSH2-Antibody-Western-Blot-NBP2-43705-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: GSH2 Antibody [NBP2-43705] - Analysis of Sample: SK-N-SH cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GSX2 protein stained by GSX2 antibody diluted at 1:200. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/GSH2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-43705-img0003.jpg)
![Immunoprecipitation: GSH2 Antibody [NBP2-43705] - Analysis of of GSX2 protein from IMR32 whole cell extracts using 5 ug of GSX2 antibody. Western blot analysis was performed using GSX2 antibody. EasyBlot anti-Rabbit IgG was used as a secondary reagent.](http://images.novusbio.com/images2/GSH2-Antibody-Immunoprecipitation-NBP2-43705-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")