SP8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SP8 Antibody [NBP2-49109] - Staining of human cell line PC-3 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human prostate shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SP8 Antibody [NBP2-49109] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SP8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HPYESWFKPSHPGLGAAGEVGSAGASSWWDVGAGWIDVQNPNSA
Specificity
Specificity of human SP8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SP8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SP8 Recombinant Protein Antigen (NBP2-49109PEP)
Publications
Read Publication using
NBP2-49109 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SP8 Antibody

  • transcription factor Sp8
  • BTD
  • Sp8 transcription factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
DPSG10
Species: Hu
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-92428
Species: Hu
Applications: WB, ICC/IF
NB300-750
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
NBP2-39052
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88220
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-38967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56340
Species: Hu
Applications: ICC/IF
NBP2-97665
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33427
Species: Hu
Applications: WB, ICC/IF, ChIP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
AF4256
Species: Hu
Applications: WB
NBP2-43705
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-49109
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SP8 Antibody (NBP2-49109)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for SP8 Antibody (NBP2-49109) (0)

There are no reviews for SP8 Antibody (NBP2-49109). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SP8 Antibody (NBP2-49109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SP8 Products

Array NBP2-49109

Bioinformatics Tool for SP8 Antibody (NBP2-49109)

Discover related pathways, diseases and genes to SP8 Antibody (NBP2-49109). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP8 Antibody (NBP2-49109)

Discover more about diseases related to SP8 Antibody (NBP2-49109).
 

Pathways for SP8 Antibody (NBP2-49109)

View related products by pathway.

PTMs for SP8 Antibody (NBP2-49109)

Learn more about PTMs related to SP8 Antibody (NBP2-49109).

Blogs on SP8

There are no specific blogs for SP8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SP8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SP8