SP110 Antibody

Images

 
Western Blot: SP110 Antibody [NBP2-56189] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: SP110 Antibody [NBP2-56189] - Staining of human cell line U-2 OS shows localization to nucleus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SP110 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PLPALIQEGRSTSVTNDKLTSKMNAEEDSEEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPE
Specificity
Specificity of human SP110 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SP110
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SP110 Recombinant Protein Antigen (NBP2-56189PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SP110 Antibody

  • FLJ22835
  • IFI41
  • IFI75
  • interferon-induced protein 41, 30kD
  • Interferon-induced protein 41/75
  • interferon-induced protein 75, 52kD
  • IPR1
  • phosphoprotein 41
  • phosphoprotein 75
  • SP110 nuclear body protein
  • Speckled 110 kDa
  • Transcriptional coactivator Sp110
  • VODI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59787
Species: Hu, Mu
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, KD
NBP1-86060
Species: Hu
Applications: WB, IHC, IHC-P, Micro
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-1813
Species: Hu
Applications: WB, ICC/IF, IP
NB100-61050
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
AF839
Species: Hu
Applications: WB
NLS418
Species: Hu
Applications: IHC, IHC-P
NBP2-59281
Species: Hu
Applications: WB, ICC/IF, IP, IF
NBP2-66778
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01787
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56189
Species: Hu
Applications: WB, ICC/IF

Publications for SP110 Antibody (NBP2-56189) (0)

There are no publications for SP110 Antibody (NBP2-56189).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP110 Antibody (NBP2-56189) (0)

There are no reviews for SP110 Antibody (NBP2-56189). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SP110 Antibody (NBP2-56189) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SP110 Products

Bioinformatics Tool for SP110 Antibody (NBP2-56189)

Discover related pathways, diseases and genes to SP110 Antibody (NBP2-56189). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP110 Antibody (NBP2-56189)

Discover more about diseases related to SP110 Antibody (NBP2-56189).
 

Pathways for SP110 Antibody (NBP2-56189)

View related products by pathway.

PTMs for SP110 Antibody (NBP2-56189)

Learn more about PTMs related to SP110 Antibody (NBP2-56189).

Blogs on SP110

There are no specific blogs for SP110, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SP110 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SP110