| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 4B11 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SP1 (NP_612482, 522 a.a. ~ 618 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSG* |
| Specificity | SP1 (4B11) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SP1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00006667-M05 | Applications | Species |
|---|---|---|
| Guo G, Li L, Song G et al. miR?7/SP1/TP53BP1 axis may play a pivotal role in NSCLC radiosensitivity Oncology Reports 2020-10-23 [PMID: 33125142] |
Secondary Antibodies |
Isotype Controls |
Research Areas for SP1 Antibody (H00006667-M05)Find related products by research area.
|
|
Nur77 Activation and Tumor Suppression Nur77 is a member of the steroid/thyroid hormone phosphoprotein receptor superfamily. It is heavily post-translationally modified and rapidly induced in response to androgens and growth factors. It governs fundamental processes such as cell proliferat... Read full blog post. |
|
Estrogen Related Receptors Play Roles in Cancer and Neurodegeneration By Eric NeeleyEstrogen receptors come in the form of two distinct forms, ER alpha and ER beta. These nuclear receptors are predominantly activated by the hormone 17-beta-estradiol to control transcription of genes throughout the immune, nervous, car... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.