SP1 Antibody (4B11)

Western Blot: SP1 Antibody (4B11) [H00006667-M05] - Analysis of SP1 expression in NIH/3T3 (Cat # L018V1).

Western Blot: SP1 Antibody (4B11) [H00006667-M05] - Analysis of SP1 expression in HeLa (Cat # L013V1).

Western Blot: SP1 Antibody (4B11) [H00006667-M05] - Analysis of SP1 expression in Raw 264.7 (Cat # L024V1).

Western Blot: SP1 Antibody (4B11) [H00006667-M05] - Analysis of SP1 expression in transfected 293T cell line by SP1 monoclonal antibody (M05), clone 4B11. Lane 1: SP1 transfected lysatE (80.693 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: SP1 Antibody (4B11) [H00006667-M05] - Detection limit for recombinant GST tagged SP1 is approximately 10ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, S-ELISA
• Clone: 4B11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

SP1 Antibody (4B11) Summary

• Immunogen: SP1 (NP_612482, 522 a.a. ~ 618 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSG*
• Specificity: SP1 (4B11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SP1 Antibody (4B11)

• Sp1 transcription factor
• specificity protein 1
• transcription factor Sp1
• TSFP1

Background

Transcription factor that can activate or repress transcription in response to physiological and pathological stimuli. Binds with high affinity to GC-rich motifs and regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Highly regulated by post-translational modifications (phosphorylations, sumoylation, proteolytic cleavage, glycosylation and acetylation). Binds also the PDGFR-alpha G-box promoter. May have a role in modulating the cellular response to DNA damage. Implicated in chromatin remodeling

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SP1
• Entrez:
  • 6667(Human)
• OMIM:
  • 189906(Human)
• Uniprot:
  • NP_612482(Human)