SOX8 Antibody (8D8)

Images

 
There are currently no images for SOX8 Antibody (H00030812-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
8D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SOX8 Antibody (8D8) Summary

Immunogen
SOX8 (NP_055402, 102 a.a. ~ 211 a.a) partial recombinant protein with GST tag.VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLL SESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSD SDSGAELGPHPGGGAVYKAEAGLGD
Specificity
SOX8 - SRY (sex determining region Y)-box 8
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SOX8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX8 Antibody (8D8)

  • MGC24837
  • SRY (sex determining region Y)-box 8
  • transcription factor SOX-8

Background

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein may be involved in brain development and function. Haploinsufficiency for this protein may contribute to the mental retardation found in haemoglobin H-related mental retardation (ART-16 syndrome).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3075
Species: Hu
Applications: WB, ICC
AF2864
Species: Hu
Applications: WB, ICC
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF5286
Species: Hu
Applications: WB
PP-H7431-00
Species: Hu
Applications: WB
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB110-59987
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61420
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P
NBP1-85823
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-32895
Species: Hu, Mu, Rt
Applications: WB
AF5077
Species: Hu
Applications: WB
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
H00030812-M02
Species: Hu
Applications: WB, ELISA

Publications for SOX8 Antibody (H00030812-M02) (0)

There are no publications for SOX8 Antibody (H00030812-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX8 Antibody (H00030812-M02) (0)

There are no reviews for SOX8 Antibody (H00030812-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX8 Antibody (H00030812-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX8 Products

Bioinformatics Tool for SOX8 Antibody (H00030812-M02)

Discover related pathways, diseases and genes to SOX8 Antibody (H00030812-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX8 Antibody (H00030812-M02)

Discover more about diseases related to SOX8 Antibody (H00030812-M02).
 

Pathways for SOX8 Antibody (H00030812-M02)

View related products by pathway.

PTMs for SOX8 Antibody (H00030812-M02)

Learn more about PTMs related to SOX8 Antibody (H00030812-M02).

Blogs on SOX8.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX8 Antibody (8D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX8
Entrez
OMIM
Uniprot