SOX1 Antibody

Images

 
Western Blot: SOX1 Antibody [NBP3-10486] - Western blot analysis using NBP3-10486 on Human Jurkat as a positive control. Antibody Titration: 0.2-1 ug/ml

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SOX1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SOX1 (NP_005977). Peptide sequence REMISMYLPAGEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTH
Clonality
Polyclonal
Host
Rabbit
Gene
SOX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for SOX1 Antibody

  • SOX1
  • SRY (sex determining region Y)-box 1
  • SRY-related HMG-box gene 1
  • transcription factor SOX-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2018
Species: Hu, Mu, Rt
Applications: CyTOF-reported, ICC, ICFlow, Simple Western, WB
AF2569
Species: Hu
Applications: ICC, WB
NB300-750
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
1845-SH/CF
Species: Hu
Applications: BA
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-37463
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
233-FB/CF
Species: Hu
Applications: BA
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
314-BP/CF
Species: Hu
Applications: BA, BA
NBP2-59059
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
7734-LF
Species: Hu
Applications: BA
423-F8
Species: Hu, Mu
Applications: BA

Publications for SOX1 Antibody (NBP3-10486) (0)

There are no publications for SOX1 Antibody (NBP3-10486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX1 Antibody (NBP3-10486) (0)

There are no reviews for SOX1 Antibody (NBP3-10486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX1 Antibody (NBP3-10486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX1 Products

Array NBP3-10486

Bioinformatics Tool for SOX1 Antibody (NBP3-10486)

Discover related pathways, diseases and genes to SOX1 Antibody (NBP3-10486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX1 Antibody (NBP3-10486)

Discover more about diseases related to SOX1 Antibody (NBP3-10486).
 

Pathways for SOX1 Antibody (NBP3-10486)

View related products by pathway.

PTMs for SOX1 Antibody (NBP3-10486)

Learn more about PTMs related to SOX1 Antibody (NBP3-10486).

Blogs on SOX1.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX1