Somatostatin R1/SSTR1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Somatostatin R1/SSTR1 Antibody [NBP2-34203] - Staining of human lymph node shows no positivity in non - germinal center cells as expected.

Immunohistochemistry-Paraffin: Somatostatin R1/SSTR1 Antibody [NBP2-34203] - Staining of human stomach shows moderate to strong positivity in luminal membrane in glandular cells.

Immunohistochemistry-Paraffin: Somatostatin R1/SSTR1 Antibody [NBP2-34203] - Staining of human upper gastrointestinal shows moderate to strong positivity in luminal membrane in glandular cells.

Immunohistochemistry-Paraffin: Somatostatin R1/SSTR1 Antibody [NBP2-34203] - Staining of human prostate shows moderate to strong positivity in apical membrane in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Somatostatin R1/SSTR1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Somatostatin R1/SSTR1 Antibody - BSA Free (NBP2-34203) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FKRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCT
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSTR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Somatostatin R1/SSTR1 Protein (NBP2-34203PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Somatostatin R1/SSTR1 Antibody - BSA Free

• G-protein coupled receptor
• Somatostatin R1
• somatostatin receptor 1
• somatostatin receptor type 1
• SomatostatinR1
• SRIF-2
• SS1R
• SS-1-R
• SS1-R
• SSR1
• SSTR1

Background

Somatostatin acts to regulate numerous physiological processes by binding to and activating specific receptors in target tissues. Activation of these receptors by somatostatin--which is secreted by nerve and endocrine cells--regulates the secretion of insulin, glucagon and growth hormone, neuronal excitability in both the brain and the peripheral nervous system, and cell growth. Somatostatin receptors have been implicated in numerous diseases ranging from Alzheimer's to cancers of the gastrointestinal tract, breast, prostate, and pituitary.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SSTR1
• Uniprot:
  • P30872(Human)