SOHLH2 Antibody

Images

 
Western Blot: SOHLH2 Antibody [NBP1-80339] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SOHLH2 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human SOHLH2. Peptide sequence LNSLHTVRYYSKVTPSYDATAVTNQNISIHLPSAMPPVSKLLPRYCTSGL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOHLH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against SOHLH2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SOHLH2 Antibody

  • bHLHe81
  • FLJ57222
  • spermatogenesis and oogenesis specific basic helix-loop-helix 2
  • spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2
  • TEB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00344018-P01
Species: Hu
NBP2-56883
Species: Hu
Applications: ICC/IF
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF739
Species: Mu, Ha
Applications: WB, IHC
NBP2-46193
Species: Hu
Applications: WB, IHC
5096-BM
Species: Hu
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-57782
Species: Hu
Applications: WB, ICC/IF
NB300-516
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IHC, IHC-P
NBP2-52405
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IP
NBP1-90657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-93938
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5510
Species: Hu
Applications: WB
NBP1-85260
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-80339
Species: Hu
Applications: WB

Publications for SOHLH2 Antibody (NBP1-80339) (0)

There are no publications for SOHLH2 Antibody (NBP1-80339).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOHLH2 Antibody (NBP1-80339) (0)

There are no reviews for SOHLH2 Antibody (NBP1-80339). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOHLH2 Antibody (NBP1-80339) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SOHLH2 Antibody (NBP1-80339)

Discover related pathways, diseases and genes to SOHLH2 Antibody (NBP1-80339). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOHLH2 Antibody (NBP1-80339)

Discover more about diseases related to SOHLH2 Antibody (NBP1-80339).
 

Pathways for SOHLH2 Antibody (NBP1-80339)

View related products by pathway.

PTMs for SOHLH2 Antibody (NBP1-80339)

Learn more about PTMs related to SOHLH2 Antibody (NBP1-80339).
 

Research Areas for SOHLH2 Antibody (NBP1-80339)

Find related products by research area.

Blogs on SOHLH2

There are no specific blogs for SOHLH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOHLH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOHLH2
Uniprot