TAF4B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TAF4B Antibody [NBP1-90657] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: TAF4B Antibody [NBP1-90657] - Staining of human salivary gland shows strong cytoplasmic positivity in subsets of glandular cells.

ChIP-Exo-Seq composite graph for Anti-TAF4B (NBP1-90657) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TAF4B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TAF4B Antibody - BSA Free (NBP1-90657) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAF4B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TAF4B Protein (NBP1-90657PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TAF4B Antibody - BSA Free

• TAF(II)105
• TAF2C2
• TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
• TAFII105
• TAFII-105
• TATA box binding protein (TBP)-associated factor 4B
• TATA box binding protein (TBP)-associated factor, RNA polymerase II, C2, 105kD
• transcription initiation factor TFIID 105 kD subunit
• transcription initiation factor TFIID 105 kDa subunit
• transcription initiation factor TFIID subunit 4B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAF4B