TAF4B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TAF4B Antibody [NBP1-90657] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TAF4B Antibody [NBP1-90657] - Staining of human salivary gland shows strong cytoplasmic positivity in subsets of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAF4B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVT
Specificity
Specificity of human TAF4B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAF4B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAF4B Antibody

  • TAF(II)105
  • TAF2C2
  • TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
  • TAFII105
  • TAFII-105
  • TATA box binding protein (TBP)-associated factor 4B
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, C2, 105kD
  • transcription initiation factor TFIID 105 kD subunit
  • transcription initiation factor TFIID 105 kDa subunit
  • transcription initiation factor TFIID subunit 4B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-75752
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00006760-B01P
Species: Hu
Applications: WB, ICC/IF
AF2944
Species: Hu
Applications: WB, Simple Western
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB300-273
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
NBP1-90657
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TAF4B Antibody (NBP1-90657) (0)

There are no publications for TAF4B Antibody (NBP1-90657).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF4B Antibody (NBP1-90657) (0)

There are no reviews for TAF4B Antibody (NBP1-90657). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TAF4B Antibody (NBP1-90657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TAF4B Products

Array NBP1-90657

Bioinformatics Tool for TAF4B Antibody (NBP1-90657)

Discover related pathways, diseases and genes to TAF4B Antibody (NBP1-90657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF4B Antibody (NBP1-90657)

Discover more about diseases related to TAF4B Antibody (NBP1-90657).
 

Pathways for TAF4B Antibody (NBP1-90657)

View related products by pathway.

PTMs for TAF4B Antibody (NBP1-90657)

Learn more about PTMs related to TAF4B Antibody (NBP1-90657).

Blogs on TAF4B

There are no specific blogs for TAF4B, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF4B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF4B
COVID-19 update