![Western Blot: SOHLH2 Antibody [H00054937-D01P] - Analysis of SOHLH2 expression in human liver.](http://images.novusbio.com/fullsize/SOHLH2-Antibody-Western-Blot-H00054937-D01P-img0001.jpg "Western Blot: SOHLH2 Antibody [H00054937-D01P] - Analysis of SOHLH2 expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | SOHLH2 (AAH25383.1, 1 a.a. - 225 a.a.) full-length human protein. MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SOHLH2 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SOHLH2 Antibody (H00054937-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SOHLH2 |
| Uniprot |
|
![Western Blot: SOHLH2 Antibody [H00054937-D01P] - Analysis of SOHLH2 expression in transfected 293T cell line by SOHLH2 polyclonal antibody.Lane 1: SOHLH2 transfected lysate(25.10 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SOHLH2-Antibody-Western-Blot-H00054937-D01P-img0002.jpg "Western Blot: SOHLH2 Antibody [H00054937-D01P] - Analysis of SOHLH2 expression in transfected 293T cell line by SOHLH2 polyclonal antibody.Lane 1: SOHLH2 transfected lysate(25.10 KDa).Lane 2: Non-transfected lysate.")
![Bioactivity GDF-9 [Unconjugated]](https://images.novusbio.com/images2/GDF9_739G9_1210.jpg)
![SDS-PAGE CXCL12/SDF-1 alpha [Unconjugated]](https://images.novusbio.com/images2/CXCL12_SDF-1_alpha_350-NS_308.jpg)
![Bioactivity CXCL12/SDF-1 alpha [Unconjugated]](https://images.novusbio.com/images2/CXCL12SDF1_alpha_350NS_1178.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Immunohistochemistry GFR alpha-1/GDNF R alpha-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GFR_alpha1_AF560_Immunohistochemistry_17364.jpg)
![Western Blot GFR alpha-1/GDNF R alpha-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/GFR_alpha-1_AF560_Western_Blot_12576.jpg)
![Immunocytochemistry/ Immunofluorescence GFR alpha-1/GDNF R alpha-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af560_rat-gfr-alpha-1-gdnf-r-alpha-1-affinity-purified-pab-8220249505912.jpg)
![Immunohistochemistry CXCR4 Antibody (44716) [Unconjugated]](https://images.novusbio.com/images2/CXCR4_MAB172_Immunohistochemistry_6955.jpg)
![Neutralization CXCR4 Antibody (44716) [Unconjugated]](https://images.novusbio.com/images2/CXCR4_MAB172_Block_Neutralize_9041.jpg)
![Immunohistochemistry CXCR4 Antibody (44716) [Unconjugated]](https://images.novusbio.com/images2/CXCR4_MAB172_Immunohistochemistry_19917.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")